(data stored in ACNUC7421 zone)

EMBL: CP002299.PE33

CP002299.PE33        Location/Qualifiers
FT   CDS_pept        39683..40927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0033"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   Twin-arginine translocation pathway, signal sequence,
FT                   subgroup; KEGG: fal:FRAAL6833 ABC-transporter
FT                   polyamine-binding lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78121"
FT                   /db_xref="GOA:E3J283"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:E3J283"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ADP78121.1"
FT                   /translation="MTTHDSTDRPGAQSPPPAVDPALLRGLTQPRLGRRQFLQAGGAAG
FT                   LAAFLAACGVKGEKKAPATADDVATFWSDKKKAGTLDFANWPLYMDTDDAGKHPSLVQF
FT                   EKDTGIHVNYRESIQDNGEYFAKVQPQLAAHQSISADLIVITNGVYLDKFIELGFLAPL
FT                   DQTKLPTFAKNADPSVKNPSYDKGNKYTVAWQSGLVGIGYDPEKTGREITSYEDLFDPA
FT                   FKGHVGMFGDNEDLPNFCMVGMGIKPETSTEADWKNAAAKLTKQRDDGIVRKYYDQGYI
FT                   DALASGDLWLSMAWSGDVYQQQAGGKNLKFVVPKEGGLFWTDNMCIPITAAHPVDAITY
FT                   MDYVYKPDVAAMLTDYINYITPVPGAKSLVDPALSGSPLIFPTADDLKKTYRYRDLTAA
FT                   EEKTWNSIFQPIVQS"
     gtgacgacgc acgacagcac ggaccgtccc ggcgcccagt cgccgcctcc cgccgtcgac        60
     ccggcgctcc tgcgcggcct cacccagccc cgcctcggcc gccggcagtt cctgcaggca       120
     ggcggcgccg ccggcctcgc ggcgttcctc gccgcctgcg gcgtcaaggg ggagaagaag       180
     gcgccggcga ccgccgacga cgtcgccacg ttctggagcg acaagaagaa ggctggcacg       240
     ctcgacttcg ccaactggcc gctctacatg gacacggacg acgccggaaa gcacccgtcg       300
     ctggtccagt tcgaaaagga caccggtatc cacgtcaact accgggagtc gatccaggac       360
     aacggcgagt acttcgcgaa ggtgcagccg cagctcgcgg cgcaccagtc gatcagcgct       420
     gacctgatcg tcatcaccaa cggcgtctac ctggacaagt tcatcgagct gggcttcctc       480
     gccccgctgg accagacgaa gctgcctacc ttcgccaaga acgccgaccc gtcggtgaag       540
     aacccttcct acgacaaggg aaacaagtac accgtcgcgt ggcagtccgg cctggtgggg       600
     atcgggtacg accccgagaa gaccgggcgc gagatcacga gctacgagga cctgttcgac       660
     cccgccttca agggccacgt cggcatgttc ggcgacaacg aggacctgcc gaacttctgc       720
     atggtcggca tgggcatcaa gccggagaca tcgaccgagg ctgactggaa gaacgccgcc       780
     gcgaagctga cgaagcagcg cgacgacggc atcgtccgca agtactacga ccagggctac       840
     atcgacgcgc tcgcctccgg cgacctgtgg ctgtcgatgg cctggtccgg cgacgtctac       900
     cagcagcagg ccggcggcaa gaacctcaag ttcgtcgtcc cgaaggaggg tggcctcttc       960
     tggaccgaca acatgtgcat cccgatcacc gccgcccacc cggtcgacgc gatcacctac      1020
     atggactacg tgtacaagcc ggacgtcgcg gcgatgctga ccgactacat caactacatc      1080
     accccggttc cgggcgcgaa gtcgctggtc gacccggcgc tttccggatc gccgctgatc      1140
     ttcccgaccg cggacgacct gaagaagacc taccggtacc gggacctcac cgcggccgag      1200
     gagaagacct ggaacagcat cttccagccc atcgtccagt cgtga                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page