(data stored in ACNUC7421 zone)

EMBL: CP002299.PE331

CP002299.PE331       Location/Qualifiers
FT   CDS_pept        complement(414922..415302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0333"
FT                   /product="blue (type 1) copper domain protein"
FT                   /note="PFAM: blue (type 1) copper domain protein; KEGG:
FT                   fal:FRAAL6560 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78419"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7E6"
FT                   /inference="protein motif:PFAM:PF00127"
FT                   /protein_id="ADP78419.1"
FT                   /translation="MAIAAALALGVTAAGCAAKEPVAPKVVAIETPTMSGDVQVFQVTG
FT                   LADLRFDVSTLEARPGKIRVDFTVARGSASHDFVIPKIPAARTDIIGAGSTQSVTFAVT
FT                   EPGDYPVICTLHPSMSATLHVG"
     gtggccatcg ccgcggcact ggcactgggc gtgacggccg cgggctgcgc ggccaaggag        60
     ccggtcgcgc ccaaggtcgt cgcgatcgag acgccgacga tgtcgggcga cgtccaggtc       120
     tttcaggtca ccggcctcgc ggacctgcgc ttcgacgtca gcaccctgga ggcgagaccc       180
     ggcaagatca gggtcgactt cacggtggcg agaggctccg cgtcccacga cttcgtcatt       240
     ccgaagatcc cggcggcgcg cacggacatc atcggcgccg ggtcgaccca gtcggtgacg       300
     ttcgcggtca ccgaaccggg cgactacccg gtgatctgca cgctgcaccc aagcatgtcc       360
     gcaacgctgc acgtcggctg a                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page