(data stored in ACNUC7421 zone)

EMBL: CP002299.PE333

CP002299.PE333       Location/Qualifiers
FT   CDS_pept        complement(416264..417079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0335"
FT                   /product="endonuclease III"
FT                   /EC_number="4.2.99.18"
FT                   /note="SMART: HhH-GPD family protein; iron-sulfur cluster
FT                   loop; Helix-hairpin-helix DNA-binding class 1; TIGRFAM:
FT                   endonuclease III; KEGG: fal:FRAAL6558 endonuclease III
FT                   (DNA-(apurinic or apyrimidinic site) lyase); PFAM: HhH-GPD
FT                   family protein; helix-hairpin-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78421"
FT                   /db_xref="GOA:E3J7E8"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7E8"
FT                   /inference="protein motif:TFAM:TIGR01083"
FT                   /protein_id="ADP78421.1"
FT                   /translation="MPATVDPSPETPGPPTRQAQTRQAQTRQAQTRQAQAQPSETPLAR
FT                   TRRARRIVRILGEVHPDARIALNFTTPLELIVATVLSAQCTDKKVNEVTPTVFARYPSA
FT                   AAYAGADRAELETILRPTGFFRAKANSVIGLGAALVDRFGGEVPRTLEELVTLPGVGRK
FT                   TANVVLGHAFDTPGITVDTHVGRLSRRFGLTTQDDPVKVEADLAALIERKDWTIASDRM
FT                   IFHGRRICHARRPACGACAVAKLCPSYGTGPTSEIEAAKLVRGDVEAAR"
     atgccagcca ccgtcgaccc gtccccggag actcccgggc ccccgacacg gcaggcacag        60
     acacggcagg cacagacacg gcaggcacag acacggcagg cacaggcgca gccgtcggag       120
     acgccgctgg cgcggacccg gcgggcacgg cggatcgtgc gcatcctggg tgaggtgcac       180
     ccggacgccc ggatcgccct gaacttcacg acgccgctgg aactgatcgt cgcgaccgtg       240
     ctctcggcgc agtgcacgga caagaaggtc aacgaggtca ctcccaccgt cttcgcccgg       300
     tacccctccg cggcggccta tgccggtgcc gaccgggccg agctggagac gatcctgcgg       360
     ccgaccggct tcttccgggc caaggcgaac tcggtgatcg gcctgggcgc cgcgctggtc       420
     gaccggttcg gcggcgaggt cccgcggacc ctcgaggagc tggtcacgct ccccggcgtc       480
     gggcgcaaga ccgcgaacgt cgtgctcggg cacgcgttcg acacgccggg catcacggtc       540
     gacacgcatg tcgggcggct ctcccgccgg ttcggcctga ccacccagga cgacccggtc       600
     aaggtcgagg ccgacctggc cgcgctgatc gagcgcaagg actggacgat cgcctccgac       660
     cgcatgatct tccacggtcg gcggatctgc catgcccggc ggccggcctg cggggcgtgc       720
     gccgtcgcga agctgtgccc gtcgtacggc acgggcccga cgtccgagat cgaggcggcc       780
     aagctggtcc gcggcgacgt cgaagcggcc cgatga                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page