(data stored in ACNUC7421 zone)

EMBL: CP002299.PE334

CP002299.PE334       Location/Qualifiers
FT   CDS_pept        complement(417215..417451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0336"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78422"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7E9"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6557"
FT                   /protein_id="ADP78422.1"
FT                   /translation="MFLFAAIAFPVVLLGLLLAMERVERPLNAADTRKGLEGFLDNARP
FT                   DEVNTFVNQGLAAALERYRRRIRRTPPGKHRAA"
     atgtttctct ttgccgccat cgcgttccct gtggtgctgc tcgggctgtt gctggcgatg        60
     gagcgggtcg agcgcccact caacgccgcc gacacccgca agggcctcga gggcttcctc       120
     gacaacgccc ggcccgacga ggtcaacacc ttcgtcaacc agggcctggc cgccgcgctc       180
     gagcgctacc gccgccggat tcgccggacc cctcccggca aacaccgggc ggcctag          237
//

If you have problems or comments...

PBIL Back to PBIL home page