(data stored in ACNUC7421 zone)

EMBL: CP002299.PE335

CP002299.PE335       Location/Qualifiers
FT   CDS_pept        417670..418359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0337"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="KEGG: fal:FRAAL6556 Crp/Fnr family transcriptional
FT                   regulator; PFAM: cyclic nucleotide-binding; regulatory
FT                   protein Crp; SMART: cyclic nucleotide-binding; regulatory
FT                   protein Crp"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78423"
FT                   /db_xref="GOA:E3J7F0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7F0"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ADP78423.1"
FT                   /translation="MDDLLARVPLFVGLSDLDRQALSSHLERRDVTRGDVLFREGEPGD
FT                   RVFVVLSGKVKIGRQSADGRENLLYVMGPGDIFGELSLFDPGPRTATATAVTDASLVSL
FT                   EHSALRPWLRARPDAGSLLLRVLAARLRRTNDAMADMVFTDVPGRVAKALLDLAGRFGE
FT                   PAQPGNEAAGVRVEHGLTQEELAQLVGASRETVNKALADFATRGWLRLDSRAVVLLDRD
FT                   RLARRAR"
     gtggacgatc tgcttgcccg cgttccgttg ttcgtcgggc tgtccgacct ggaccgccag        60
     gcgctctcca gtcacctcga acggagggac gtcacccgtg gtgacgtgct cttccgggaa       120
     ggggagcctg gcgaccgcgt cttcgtggtc ctatccggca aggtgaagat aggacgccag       180
     tcggccgacg ggcgcgagaa cctcttgtat gtcatgggcc caggggacat cttcggagaa       240
     ttgtcgctct tcgacccagg ccctcggacc gcgaccgcga cggccgtgac agacgcctca       300
     ctggtgtcgc tggagcactc ggcgctgcga ccgtggctgc gggcccggcc ggacgccggg       360
     tcgctgctgc tgcgggtgct ggccgcccgg ttgcgccgga ccaacgacgc catggccgac       420
     atggtgttca ccgacgtgcc cggccgagtc gccaaggcgc tgctcgacct cgccggacgg       480
     ttcggtgagc ccgcgcagcc tggcaacgag gccgccgggg tccgcgtcga gcatggcctg       540
     acccaggagg aactggccca gctggtcggc gcctcccggg agacggtcaa caaggcgctg       600
     gccgacttcg ccacccgagg gtggctgcgg ctggactccc gcgcggtcgt gctgcttgac       660
     cgcgaccggc tggcccgccg cgcccggtga                                        690
//

If you have problems or comments...

PBIL Back to PBIL home page