(data stored in ACNUC7421 zone)

EMBL: CP002299.PE340

CP002299.PE340       Location/Qualifiers
FT   CDS_pept        complement(424994..425161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0342"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sro:Sros_0464 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78428"
FT                   /db_xref="InterPro:IPR025234"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7F5"
FT                   /inference="similar to AA sequence:KEGG:Sros_0464"
FT                   /protein_id="ADP78428.1"
FT                   /translation="MQKWEYVTVPVLIHSTKMILDNWGEDGWELVQVIQGPNPESLVAY
FT                   FKRPKGEPTA"
     atgcagaagt gggagtacgt caccgtccca gtcttgatcc actcgaccaa gatgatcctc        60
     gacaactggg gcgaggacgg ctgggagctc gtgcaggtca tccaggggcc gaacccggag       120
     agtctggtcg cctacttcaa gcgcccgaag ggcgagccga cggcgtga                    168
//

If you have problems or comments...

PBIL Back to PBIL home page