(data stored in ACNUC7421 zone)

EMBL: CP002299.PE342

CP002299.PE342       Location/Qualifiers
FT   CDS_pept        426405..427742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0344"
FT                   /product="putative anion-transporting ATPase"
FT                   /note="KEGG: fal:FRAAL6549 putative anion-transporting
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78430"
FT                   /db_xref="GOA:E3J7F7"
FT                   /db_xref="InterPro:IPR016300"
FT                   /db_xref="InterPro:IPR025723"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7F7"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6549"
FT                   /protein_id="ADP78430.1"
FT                   /translation="MSPAANGDGGPPARPKRSAPPTGRAKTPAAKKPATKGTGTAKERS
FT                   GKDEPAPVVRIHARVRPQPAGVPRLDIDELLATERIIVCCGSGGVGKTTTAAALALRAA
FT                   EQGRAVVVLTIDPARRLAQSMGLTELDNTPREVLGVDRSAGGRLDAMMLDMKRTFDEIV
FT                   LAHATPDRAEQLLANPFYQSLSSSFSGTQEYMAMEKLGQLDAADDWDLIVVDTPPTRSA
FT                   LDFLDAPSRLGAFLDGRLLRLMLAPAKAGGRAYAKVLGVGFGVFTRVLTKVIGTQLLTD
FT                   LSQFVTALETMFGGFRQRAEKTYRLLGAPGTSFVVVAAPEVAALREASYFVDRLDADGM
FT                   PLAGLVINRMHQSDGRVLTTERSLAAAENLTEHGEHPLAAAVLRVHADRLRLAERESRL
FT                   RERFTSVHPDTPLVEVEALAEDVHDLAGLREIGDALAGDVRLTRAI"
     gtgagcccgg ccgcgaacgg cgacggcggc ccgcccgcgc ggccgaagcg gtccgcgccg        60
     cccaccggcc gggcgaagac cccggcggcg aagaagccag cgacgaaggg gaccggtacc       120
     gccaaggaac gttcgggcaa ggacgagccg gcccccgtcg tccggattca cgcgcgggtg       180
     cgcccgcagc cggcgggagt accgcgcctc gacatcgacg agctgctggc caccgagcgg       240
     atcatcgtct gctgcggatc cggcggggtg ggcaagacga cgaccgccgc cgcgctcgcg       300
     ttgcgggccg ccgagcaggg ccgggccgtg gtcgtcctga cgatcgaccc tgcgcgccgg       360
     ctcgcgcagt cgatgggcct caccgagctg gacaacaccc cgcgggaggt gctcggtgtc       420
     gaccggtcgg ccggcgggcg cctcgacgcg atgatgctgg acatgaagcg gacgttcgac       480
     gagatcgtcc tggcgcacgc cacgccggac cgggcggagc agctgctcgc gaaccccttc       540
     taccagtcgc tgtcgtcgtc cttctccggc acgcaggagt acatggcgat ggagaagctg       600
     ggccagctgg acgcggccga cgactgggac ctgatcgtcg tcgacacccc gccgacccgc       660
     tcggccctgg acttcctgga cgccccgagc cggctgggcg cgttcctgga cggccggctg       720
     ctgcggctga tgctggcgcc ggcgaaggcg ggcgggcggg cgtacgcgaa ggtgctcggt       780
     gtcgggttcg gcgtgttcac cagggtgctg accaaggtca tcggaaccca gctgctgacc       840
     gacctcagcc agttcgtgac ggcgctggag acgatgttcg gcggtttccg ccagcgggcg       900
     gagaagacct accgcctgct cggcgctccc ggtacgtcgt tcgtcgtggt cgcggccccc       960
     gaggtcgcgg cgctgcggga ggcgagctac ttcgtcgacc ggctcgacgc ggacggcatg      1020
     cccctggccg gcctggtgat caaccggatg caccagagcg acggcagggt gctgacgacg      1080
     gagcggagcc tggccgccgc ggagaacctg accgagcacg gggagcatcc gctggcagcc      1140
     gcggtgcttc gggtgcacgc ggaccggctg cggctggcgg agcgggagtc gaggctgcgc      1200
     gagcggttca cctcggtcca ccccgacacg cctctggtcg aggtcgaggc gctggccgag      1260
     gacgtccatg acctggccgg cctgcgcgag atcggcgatg cgctcgcggg tgacgtgcgt      1320
     ctcactcgcg cgatctga                                                    1338
//

If you have problems or comments...

PBIL Back to PBIL home page