(data stored in ACNUC7421 zone)

EMBL: CP002299.PE343

CP002299.PE343       Location/Qualifiers
FT   CDS_pept        complement(427908..428264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0345"
FT                   /product="transcription factor WhiB"
FT                   /note="PFAM: transcription factor WhiB; KEGG: fal:FRAAL6548
FT                   WhiB family cell cycle control transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78431"
FT                   /db_xref="GOA:E3J7F8"
FT                   /db_xref="InterPro:IPR003482"
FT                   /db_xref="InterPro:IPR034768"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7F8"
FT                   /inference="protein motif:PFAM:PF02467"
FT                   /protein_id="ADP78431.1"
FT                   /translation="MTRSPTPAVSTARRGGTTRLVSGIADGDWTALAACRDVDPDELFV
FT                   QGAAQNRVKTRCFGCLVRTQCLADALDNHVEFGVWGGMTERERRALLRRRPDVRSWRKL
FT                   LADAQADHRTTSTG"
     atgaccagaa gcccaactcc ggccgtctcc acggctcgcc gtggcggaac cacccgtctc        60
     gtcagcggca tcgccgatgg cgactggacc gcgctcgccg cgtgtcgcga cgtcgacccg       120
     gatgagctgt tcgtgcaggg cgccgcgcag aaccgggtga agacccgctg cttcggctgc       180
     ctcgtgcgga cccagtgcct cgccgacgcc ctcgacaatc acgtcgagtt cggcgtgtgg       240
     ggtggcatga ccgaacggga acgccgcgcg ctgctgcgac gccgcccgga cgtccgctcc       300
     tggcggaagc tgctcgctga cgcccaggcg gaccaccgga ccacctcgac cggctga          357
//

If you have problems or comments...

PBIL Back to PBIL home page