(data stored in ACNUC7421 zone)

EMBL: CP002299.PE345

CP002299.PE345       Location/Qualifiers
FT   CDS_pept        complement(431414..431869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0347"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL6545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78433"
FT                   /db_xref="GOA:E3J7G0"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7G0"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6545"
FT                   /protein_id="ADP78433.1"
FT                   /translation="MNTLKERLRADLTTAMKARDELRTSTLRLAISAVKEAEVAGKSAH
FT                   ELTDDEVEKVLTREVRKRREAADAYAGAGRAEQAARERSEGEVLADYLPKQLGDDELAA
FT                   IVDKVLADGDFAGPKAIGPAMKAVQAIVAGRADGGKVAGLVKARLTA"
     atgaacacct tgaaggagcg gctgcgcgcc gacctgacga cggcgatgaa ggcccgggac        60
     gagctgcgga cgtcgacgct gcgactcgcg atctcggcgg tgaaggaagc cgaggtggcc       120
     ggcaagtcgg cccacgagct caccgacgac gaagtggaga aggtgctgac ccgggaggtc       180
     cgcaagcgcc gcgaggctgc cgacgcctac gcaggcgccg gccgcgccga gcaggccgcc       240
     cgggagcgct ccgagggcga ggtcctggcc gactacctgc cgaagcagct cggcgacgac       300
     gagctcgccg cgatcgtcga caaggtgctc gccgacggcg acttcgccgg gccgaaggcg       360
     atcggcccgg ccatgaaggc cgtgcaggcg atcgtcgccg gccgcgccga cggcggcaag       420
     gtcgccggcc tcgtcaaggc gcggctgacg gcctga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page