(data stored in ACNUC7421 zone)
EMBL: CP002299.PE345
CP002299.PE345 Location/Qualifiers
FT CDS_pept complement(431414..431869)
FT /codon_start=1
FT /transl_table=11
FT /locus_tag="FraEuI1c_0347"
FT /product="hypothetical protein"
FT /note="KEGG: fal:FRAAL6545 hypothetical protein"
FT /db_xref="EnsemblGenomes-Gn:FraEuI1c_0347"
FT /db_xref="EnsemblGenomes-Tr:ADP78433"
FT /db_xref="GOA:E3J7G0"
FT /db_xref="InterPro:IPR003789"
FT /db_xref="InterPro:IPR019004"
FT /db_xref="InterPro:IPR023168"
FT /db_xref="InterPro:IPR042184"
FT /db_xref="UniProtKB/TrEMBL:E3J7G0"
FT /inference="similar to AA sequence:KEGG:FRAAL6545"
FT /protein_id="ADP78433.1"
FT /translation="MNTLKERLRADLTTAMKARDELRTSTLRLAISAVKEAEVAGKSAH
FT ELTDDEVEKVLTREVRKRREAADAYAGAGRAEQAARERSEGEVLADYLPKQLGDDELAA
FT IVDKVLADGDFAGPKAIGPAMKAVQAIVAGRADGGKVAGLVKARLTA"
atgaacacct tgaaggagcg gctgcgcgcc gacctgacga cggcgatgaa ggcccgggac 60
gagctgcgga cgtcgacgct gcgactcgcg atctcggcgg tgaaggaagc cgaggtggcc 120
ggcaagtcgg cccacgagct caccgacgac gaagtggaga aggtgctgac ccgggaggtc 180
cgcaagcgcc gcgaggctgc cgacgcctac gcaggcgccg gccgcgccga gcaggccgcc 240
cgggagcgct ccgagggcga ggtcctggcc gactacctgc cgaagcagct cggcgacgac 300
gagctcgccg cgatcgtcga caaggtgctc gccgacggcg acttcgccgg gccgaaggcg 360
atcggcccgg ccatgaaggc cgtgcaggcg atcgtcgccg gccgcgccga cggcggcaag 420
gtcgccggcc tcgtcaaggc gcggctgacg gcctga 456
//
If you have problems or comments...
Back to PBIL home page