(data stored in ACNUC7421 zone)

EMBL: CP002299.PE348

CP002299.PE348       Location/Qualifiers
FT   CDS_pept        complement(433971..434840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0350"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fal:FRAAL5406 glycine-rich cell wall
FT                   structural protein precursor (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78436"
FT                   /db_xref="UniProtKB/TrEMBL:E3J7G3"
FT                   /inference="similar to AA sequence:KEGG:FRAAL5406"
FT                   /protein_id="ADP78436.1"
FT                   /translation="MRSRRLTRQRNARLTAVSVAAAATCAALLTGCALTGPGPGGSGPV
FT                   ATSSPTPTPSTSTPATTPTPTVKPTSTGSTASTSPTPTADSRKAVYLGGNYSNGVFSVG
FT                   VIPYGGSTNPALTGTFLIHEGSTLIGQVNVAYDPTDGYYGGHFNLTLAPGRHTFTYDYS
FT                   GDASYQPAHDTGKIDVTNVTITASVPGGTVVWGQPITVDIQVSPIPGVTGIPTGKVTND
FT                   SSFAFDTAEATLDATGHATLTVPPSPYLTSGTTRQDNYPIYINYAGDDTFTPWRVMVLF
FT                   TFLPAPTS"
     atgcggtcgc gacgtctcac gcgccagcgg aacgcccggc tgacggcggt cagcgtcgcc        60
     gccgccgcga cctgcgccgc cctgcttacg ggctgcgcgc tgaccggccc cggccccggt       120
     ggcagcggcc cggtcgccac ctcgtccccg acgcccaccc cgtcgaccag caccccggcg       180
     accacgccga ccccgaccgt caagccgacg tcgaccggga gcaccgcatc cacatcgccg       240
     acgccgacgg ctgacagccg caaggcggtc tacctcggcg gcaactactc gaacggcgtc       300
     ttctccgtgg gcgtcatccc gtacggcggt agcaccaacc ccgcgctgac cggcacgttc       360
     ctcatccacg agggaagcac cctgatcggc caggtgaacg tcgcctacga cccgaccgac       420
     gggtactacg gcggccactt caacctcacg ctcgcgcccg gccggcacac gttcacctac       480
     gactacagcg gcgacgccag ctaccagccg gcccatgaca cgggcaagat cgacgtcacc       540
     aacgtcacga tcaccgcgtc ggtaccgggc ggcaccgtcg tctggggaca gccgatcacc       600
     gtcgacatac aggtgagccc gatcccgggc gtgactggca tcccgaccgg gaaggtcact       660
     aacgactcca gcttcgcctt cgacacggcc gaagcaaccc tggacgcgac cggtcacgcg       720
     actctcaccg tcccgccgtc gccgtacctg acatcgggca cgacgaggca ggacaactac       780
     ccgatctaca tcaactacgc gggcgacgac accttcaccc cgtggcgcgt gatggtcctg       840
     ttcaccttcc tccccgcccc caccagttag                                        870
//

If you have problems or comments...

PBIL Back to PBIL home page