(data stored in ACNUC7421 zone)

EMBL: CP002299.PE35

CP002299.PE35        Location/Qualifiers
FT   CDS_pept        41858..42733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0035"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: fal:FRAAL6835 polyamine ABC
FT                   transporter transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78123"
FT                   /db_xref="GOA:E3J285"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3J285"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP78123.1"
FT                   /translation="MSAPTVATTAPAPAARRRPRVRWGAHLMHAYTWLILLWLVAPIIF
FT                   MIVFSFNDTHSRQNTHWQGFTFKWWGRLGAYPDLTSSLVNSLTIGVLSTLIATAFGTMI
FT                   GMAIGKHSFRGQGGVNLLLFANIAAPEVVLGSSLLSLFITMNIPRGYLTILIAHVMFNL
FT                   AYVAVVVSTRLASFDMSLEEAARDLGAGPWATFRLVTLPIILPGILSGAMLAFSLSIDE
FT                   YIITAFNAGGTLTFPLWVMGATKNGVPPQVNVMATIIFVGGIVLAVGGFVVGRGAKARA
FT                   PEEDLGVVSA"
     atgagcgccc ccaccgtggc gacgaccgca ccggcaccgg cagcgcgacg gcgtccgcgc        60
     gtccgctggg gcgcgcacct gatgcacgcc tacacctggc tgatcctgct gtggctggtc       120
     gcaccgatca tcttcatgat cgtcttcagc ttcaacgaca cgcacagccg gcagaacacc       180
     cactggcagg gcttcacctt caagtggtgg gggcggctcg gggcctaccc cgacctcacc       240
     agctccctgg tgaactcgtt gacgatcggc gtgctgtcga ctttgatcgc gacggctttc       300
     ggcacgatga tcggcatggc gatcgggaaa cactcgttcc gcggccaggg cggcgtcaac       360
     ctgctgcttt tcgcgaacat cgccgcgccc gaggtggtgc tgggctcgtc gctgctctcg       420
     ctgttcatca cgatgaacat cccgcgcggg tacctgacaa tcctgatcgc gcacgtcatg       480
     ttcaacctgg cttatgtcgc ggtggtcgtc agcacccggc tggccagttt cgacatgagc       540
     ctcgaagagg cggcccgcga cctgggcgcc ggcccctggg cgacgttccg gctggtgacg       600
     ctaccgatca tcctgccggg catcctgtcc ggcgcgatgc tggcgttctc gctgtcgatc       660
     gacgagtaca tcatcacggc gttcaacgcg ggcggcacgc tcacgttccc gctgtgggtc       720
     atgggcgcga cgaagaacgg tgtcccgccg caggtcaacg tgatggcgac gatcatcttc       780
     gtcggcggca tcgtgctggc cgtcgggggt ttcgtcgtcg gccgcggcgc gaaggcccgc       840
     gcgcccgagg aggacctggg cgtcgtctcc gcctga                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page