(data stored in ACNUC7421 zone)

EMBL: CP002299.PE350

CP002299.PE350       Location/Qualifiers
FT   CDS_pept        complement(435822..437459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0352"
FT                   /product="integral membrane sensor signal transduction
FT                   histidine kinase"
FT                   /note="KEGG: fal:FRAAL2981 putative two-component sensor;
FT                   PFAM: histidine kinase dimerisation and phosphoacceptor
FT                   region; ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78438"
FT                   /db_xref="GOA:E3J8J5"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8J5"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ADP78438.1"
FT                   /translation="MGPPDWPFPANRPTELEGVTMGPMESFGHWRRGRAGLTALAVRQD
FT                   PPDVPGVVFGRMRHSRIGTALRAHPVLVDSTLALAVCVLALVPLALPPHGPEGAILLLT
FT                   LAATAPLCLRRSYPLGTFVVCALVSLAQILLWVPSFGTFTSLLIEFYTVAKWCSRRATS
FT                   AAAASVTAWILWFCVRLPQVRAVDRVGVALVFLPAAVAAGVLGVNANTRRAYVASITDR
FT                   ANRAERERDQQARLAAAGERSRIAREMHDIVAHNLSVMIALADGAGYTLRDLLGDAADP
FT                   QDQRVRRATKAVESVSATGREALAQMRSLLGVLRDDGGLTQPADGGLGPDGALSGNWPA
FT                   GDPGLDVVEQWGDAAGPGLDGGPRPDEPARAPQPRIADLNRLIEQVRHAGPTVGFLVTG
FT                   QRRELPTDAELTVFRIVQESLTNVLKHTGPRANAVVRLGFDPSGVDIEITDTGSAPDDG
FT                   SDRSVAEGPRSPGRGISGMRERAALHGGTLVAGPGAGGWRVAARIVAPAGPPPVAATGQ
FT                   APEVPPARAVATPPGTEASRYSEGAPRP"
     atgggcccgc cggactggcc gttcccggca aaccgcccca ccgagctcga aggcgtcacg        60
     atgggtccta tggaatcgtt cggccactgg cgccgcggcc gggccgggct gacagcgctg       120
     gcggtccggc aggacccgcc ggacgttccc ggcgtggtct tcggccggat gcggcacagc       180
     cggatcggga cggcgctgcg cgcccacccc gtcctcgtcg actccacgct ggcgctcgcg       240
     gtctgcgtcc tggcgctggt gccgttggcg ttgccgccgc acgggccgga aggcgcgatc       300
     ctgctgctca ccctcgcggc gacggcgccg ctgtgcctgc ggcgcagcta cccgctcggg       360
     acgttcgtcg tctgcgccct ggtgtcgctg gcgcagatcc tgctgtgggt gccgtcgttc       420
     ggcacgttca cgtcgctgct gatcgagttc tacaccgtcg cgaagtggtg ctcacggcgg       480
     gcgacctcgg ccgccgccgc gtccgtcacg gcctggatcc tctggttctg cgtcagactg       540
     ccgcaggtcc gcgcagtcga ccgggtcggg gtggcgctcg tcttcctgcc ggcggcggtc       600
     gcggccgggg tgctcggcgt gaacgcgaac acccgtcggg cctacgtggc ctcgatcacc       660
     gaccgcgcca accgggccga gcgtgaacgt gaccagcagg cacggctggc ggcggccggc       720
     gaacgctccc gaatcgcccg cgagatgcac gacatcgtgg cgcataacct ttccgtcatg       780
     atcgcgctgg ccgacggcgc cggctacacc ctgcgtgacc tgctcggcga cgcggcggac       840
     ccgcaggacc agcgggtacg ccgcgcgacc aaggcggtcg aatcggtgtc ggccaccggc       900
     cgggaggccc tcgcgcagat gcgcagcctg ctcggcgtcc tgcgagacga cggcggcctc       960
     acccagccgg cggacggtgg cctcggcccc gacggcgcgc tcagcgggaa ctggccagcc      1020
     ggcgacccgg gcctcgacgt cgtcgagcag tggggtgatg ccgccgggcc gggcctggac      1080
     ggtgggcctc gcccggacga gccggccagg gcgccccagc cgcggatcgc cgacctcaac      1140
     cggctgatcg agcaggtccg gcacgccggg ccgaccgtcg ggttcctcgt gaccggccag      1200
     cgccgggagc tgccgaccga cgccgagctg acggtcttcc ggatcgttca ggaatcgctg      1260
     accaacgtcc tcaagcacac cgggccacgg gccaacgccg tggtccggct gggattcgat      1320
     cccagcggag tcgacatcga gatcaccgac accgggtcgg ctcccgacga cgggtcggac      1380
     cggtcggtgg ccgaggggcc gaggtcaccc ggccggggga tttcgggcat gcgggaacgc      1440
     gccgcgctcc acggtggaac gctcgtcgcc ggccccgggg ccggcgggtg gcgggtggcc      1500
     gcgcgcatcg tcgccccggc gggaccgcca ccggtcgcgg cgaccggcca ggcgcctgaa      1560
     gtgccgccgg cacgcgcggt cgccacgccg ccggggactg aggcgagtcg atactccgag      1620
     ggagccccgc gcccatga                                                    1638
//

If you have problems or comments...

PBIL Back to PBIL home page