(data stored in ACNUC7421 zone)

EMBL: CP002299.PE351

CP002299.PE351       Location/Qualifiers
FT   CDS_pept        complement(437502..438326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0353"
FT                   /product="putative ABC transporter transmembrane protein"
FT                   /note="KEGG: fal:FRAAL2980 putative ABC transporter
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78439"
FT                   /db_xref="GOA:E3J8J6"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8J6"
FT                   /inference="similar to AA sequence:KEGG:FRAAL2980"
FT                   /protein_id="ADP78439.1"
FT                   /translation="MNTTTIADARLGVGTGDVTQLRVVHSEWVKLRSLRSTGWTLGSAV
FT                   LLLIGLGLPLCLQASHHWSPAEVQSRDQDPVFQSLGGLLLAQIPIGVLGVLTMTGEYAT
FT                   GMIRATLGLVPKRLPVLWAKVAVFGAASFVLMLVAALVSFLVGQVPLSHHGVGVTLGSP
FT                   GAARAVLGAAGYLALVGLLGLALGALLRHTAGAVSALLGVLLGLPILFGLLPESWQPAA
FT                   RFLPTLLGEGMASTSPPSVTHQLSPGLCFVVMSLYTVVGLVAGAFVLARRDV"
     atgaacacca cgacgatcgc ggacgcccgg ctcggcgtgg gcacgggaga tgtcacccag        60
     ctgcgggtcg tgcactcgga atgggtcaag ttgcggtccc tgcgctcgac cggctggacg       120
     cttggctcag cggtcctcct gctcatcggc ctcggccttc ccctctgcct gcaggcctcg       180
     caccactggt ctccggccga ggtccagtcc agagaccagg acccggtgtt ccagtcgctg       240
     ggcgggctcc tgctggcgca gatccccatc ggcgtgctcg gggtgctgac gatgaccggc       300
     gagtacgcca ccggaatgat ccgggccacg ctcggcctgg tgccgaagcg gcttccggtg       360
     ctgtgggcca aggtggccgt cttcggggcg gcgtcgttcg tgctcatgct ggtcgccgcg       420
     ctcgtctcgt tcctcgtcgg ccaggtgccc ctgtcacacc acggcgtcgg agtcacgctc       480
     ggcagccccg gagccgcccg tgcggtgctc ggcgccgccg ggtacctggc cctcgtcggc       540
     ctgctcggac tcgccctcgg cgcgttgctt cggcacaccg ccggcgcggt gtcggcgctg       600
     ctcggtgtcc tgctgggact gccgatcctg ttcgggctgc tgccggaaag ctggcagccc       660
     gcggcgcgct tcctgccgac cctgctgggc gagggcatgg cgtcgaccag cccgcccagc       720
     gtcacccatc agctctcccc cgggctgtgc ttcgtcgtga tgtccctcta caccgtcgtc       780
     gggctggtcg ccggcgcgtt cgtcctcgcc cggcgggacg tctga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page