(data stored in ACNUC7421 zone)

EMBL: CP002299.PE355

CP002299.PE355       Location/Qualifiers
FT   CDS_pept        441481..442320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0357"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: fal:FRAAL1557 putative ABC
FT                   transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78443"
FT                   /db_xref="GOA:E3J8K0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8K0"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ADP78443.1"
FT                   /translation="MSSTAQAHAAARTGNRTAGRQGRLVRVFRRYGPAAVVLVAILAAW
FT                   ELATVVFGVEDYILPAPSAVVRALVDRWNGTLASATWVTLTEVLLGFAIAVAAGLVTAS
FT                   CLHFSRIARAALYPWLIGSQTVPVVVIAPVLAIIFGYTLTPKLILVALLCFFPIVVATL
FT                   DGLAAVEPDLVRLMRTLYGSRWAIFRRVELPAALPSMFTGLRLSAAYAATAAVFGEYSG
FT                   SSDGLGHVMRQAVPQLQSALVFAAIALLSAMSVALFVLVTVLERLLVGWAHEGKKVR"
     atgtcgtcaa cggcgcaagc gcacgcagca gcccggaccg ggaatcggac ggcagggcgc        60
     caggggaggc ttgtccgggt cttccggcgt tatggcccgg ccgcggtcgt tctggtggcg       120
     atcctggctg cctgggagct ggccaccgtc gtgttcggtg tcgaggacta catcctgccg       180
     gcgccgagcg cggtcgtccg tgccctggtt gaccgctgga acggcacgtt ggcgagcgcc       240
     acctgggtga ccctgaccga ggtcctgctc gggttcgcga tcgcggtggc cgccgggctg       300
     gtgaccgcgt cctgcctgca tttctcgcgg atcgctcggg cggcgctgta tccctggctg       360
     atcggctccc agaccgtgcc cgtggtcgtg attgccccgg ttctcgcgat cattttcggc       420
     tacacgctga cgccgaagct gatcctcgtc gcgctgctct gcttctttcc catcgtggtc       480
     gcgacgctgg acggtctggc ggccgtcgag ccggacctcg tccggctgat gcgaaccctc       540
     tatggcagtc gctgggccat cttccgacga gtggagctgc cggctgcgct tccgtccatg       600
     ttcaccgggc tgcggctgtc ggcggcgtat gcggcgaccg ccgccgtgtt cggcgagtat       660
     tccggttcct ccgacggcct cgggcatgtg atgcgccagg ccgttccgca gttgcagagc       720
     gcgctggtct tcgccgcgat cgcgctgctc tccgcgatgt ctgtcgcctt gttcgtgctg       780
     gtcaccgtcc tggagcggtt gctggtcggc tgggctcacg aagggaagaa ggtccgatga       840
//

If you have problems or comments...

PBIL Back to PBIL home page