(data stored in ACNUC7421 zone)

EMBL: CP002299.PE358

CP002299.PE358       Location/Qualifiers
FT   CDS_pept        complement(443823..444473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0360"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: rer:RER_47160
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78446"
FT                   /db_xref="GOA:E3J8K3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR041642"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8K3"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADP78446.1"
FT                   /translation="MAKEETLPQPVSTMTAAQLARRRRLTDAVIEMIDQVPPDQLQMRD
FT                   VAERSGVALGTAYRYFSSKDHLLAAAWADWQRRLTDRVRGEVSRDHGRSGSAAVPPVGA
FT                   CTRVVGFLHREIRAFQRHPNFARLVTHVEVASDPFASEEIAGLADDNRTVMAALMSGVP
FT                   PEVARPATIAINATLASGLASWTAGRLTFPDLVRQLEDVTRLVLRDYDDTAAG"
     gtggcgaaag aggaaacgct gccgcagccg gtgagcacga tgacggctgc gcagctcgcg        60
     cggcggcggc ggctgaccga cgccgtgatc gagatgatcg accaggtgcc gccggaccag       120
     ctccagatgc gcgatgtcgc cgagcgttcc ggcgtcgcgc tcgggacggc ctaccgctat       180
     ttctcgtcga aggaccacct gctcgccgcc gcctgggccg actggcagcg gcggctgacc       240
     gaccgggtac gcggcgaggt ctcccgtgac cacgggagaa gcggatccgc ggctgtgccg       300
     cccgtcgggg cctgcacccg cgtcgtcggc tttctgcacc gggagatccg ggccttccag       360
     cgccacccga acttcgcccg gctcgtcacg cacgtcgagg tcgccagcga cccgttcgcg       420
     agcgaggaga tcgccggtct cgccgacgac aaccggaccg tgatggccgc cctgatgagc       480
     ggagtgccgc cggaggtcgc ccggccggcg acgatcgcga tcaatgcgac gctcgcgtcc       540
     gggctggcct cctggaccgc cggccgcctc accttccccg atctcgtccg tcagttggaa       600
     gacgtcaccc gcctcgttct ccgcgactac gacgacaccg cagccggctg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page