(data stored in ACNUC7421 zone)

EMBL: CP002299.PE359

CP002299.PE359       Location/Qualifiers
FT   CDS_pept        complement(444638..446857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0361"
FT                   /product="acyl-CoA dehydrogenase domain-containing protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain-containing
FT                   protein; KEGG: rer:RER_04020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78447"
FT                   /db_xref="GOA:E3J8K4"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8K4"
FT                   /inference="protein motif:PFAM:PF02771"
FT                   /protein_id="ADP78447.1"
FT                   /translation="MSIGLTEEHSALAASVRGFVTRHAPSTATRAELDQYAAGKPVPYW
FT                   DGLVELGLTSLHLPEEFAGAGAGYVELAVALEETARGLVPGHLLPTVLTSALLAHHGGD
FT                   DLRKRHLPGLAAGTLGASALAAAGLRATPAGDGGYTVSGVSVPVLGAAGAELLLLGARL
FT                   DDGELWFVTDPDAPGLRVEPATAVDLTRGVARIRLDGVRVDAEQVVALDTESARTLAVV
FT                   LFAAEAVGVARWLLTTGVEYVKVREQFGQVVGSFQAIKHRCARMLVRVETMSAAAWDAA
FT                   RAVEQGDEQLALAAAEAAVLCLAGATELGLDTVTLLGGIGYTWEHDTHLYWRRAMALES
FT                   LLGPVSAFEHRLGELVGGAPRETAGQSTAAGGPTRDFTLELPDEDPAFRARIASVLGEV
FT                   ASLPAADRQRRLADEGLVLPHYPRPYGIAATPLEQLVIQQEYERSGVTQPKTIIGEWAM
FT                   PTILAHGTDEQKATLVPATLRGEITWCQLFSEPGAGSDLAALSTRAEKVEGGWRLNGQK
FT                   VWNSMAERANYGICLARTNPDVPKHRGISYFLVDMKTPGIDVRPLREANGNYLFNEVFF
FT                   TDVLVPEDRIVGEPDKGWALARTTLGNERVAMGGMRELRMDLPALAASGELVTDPGDVR
FT                   RDIGALYALAFALSAMSLRSTLRTLSGLRPGAEASVAKVAASFLNTDVGTRVLRWFGPS
FT                   AASADGPAAAAVHQYLSIPPHLIGGGTIEIQLNVISERVLGLPRG"
     gtgtcgattg gcctgacgga ggagcactcc gcgctcgctg cctccgtgcg gggtttcgtc        60
     acccgccatg ccccgtccac cgcgacccgc gccgagctcg accagtacgc ggccggaaaa       120
     ccggttccgt actgggacgg gctggtggag ctggggctga cgtcgctgca cctgcccgag       180
     gagttcgccg gtgccggcgc gggctacgtg gagctggcgg tcgcgctgga ggagaccgcc       240
     cgcggcctgg tgcccgggca cctgctcccg accgtgctga ccagcgcgct gctggcccac       300
     cacggcggcg acgacctgcg caagcggcat ctgcccgggc tggccgccgg aactctcggc       360
     gcgagcgccc tggccgccgc cgggctgcgc gcgacgccgg ccggcgacgg cggctacacc       420
     gtgtccggcg tgagcgtccc ggtgctcggc gcggcggggg cggagctgct cctgctcggg       480
     gctcggctcg acgacggcga gctgtggttc gtcaccgacc cggacgcccc cgggctgcgg       540
     gtcgagccgg ccaccgccgt cgacctgacc cgtggcgtcg cccggatccg gctcgacggt       600
     gtccgggtcg acgccgaaca ggtggtcgcc ctcgacaccg agtccgcgcg cacgctcgcg       660
     gtcgtcctgt tcgccgccga ggcggtcggc gtggctcgct ggctgctcac caccggtgtg       720
     gagtacgtga aggtgcgcga gcagttcggc caggtggtcg gctcgttcca ggccatcaag       780
     catcggtgcg cgcggatgct ggtccgggtc gagacgatgt cggccgccgc ctgggacgcg       840
     gcgcgcgccg tcgagcaggg cgacgagcag ctcgcgctcg ccgccgcgga ggccgccgtt       900
     ctgtgcctcg ccggcgccac cgagctcggc ctggacaccg tcaccctgtt gggcggcatc       960
     ggctacacct gggaacacga cacccacctg tactggcggc gcgcgatggc gctggaaagc      1020
     ctgctcgggc cggtttcggc tttcgagcac cggctcggcg agctggtcgg cggcgcgccg      1080
     cgggaaaccg ccgggcagtc gaccgccgcc ggcgggccga cccgcgactt cacgctcgaa      1140
     ctgccggacg aggatccggc gttccgggcc cggatcgcct cggtgctcgg cgaggtcgca      1200
     agccttcccg cggccgaccg acagcgccgg ctggccgatg aggggctggt tctcccgcac      1260
     tatccacgcc cctacgggat cgcggcgaca ccgctggagc agctcgtcat ccagcaggaa      1320
     tacgaacgtt ccggcgtcac ccagccgaag accatcatcg gtgaatgggc gatgccgacg      1380
     atcctcgcgc acggcaccga cgagcagaag gcgacactcg taccggcgac gctgcgcggc      1440
     gagatcacct ggtgccagct gttcagcgag cccggggccg gttcggacct cgcggccctg      1500
     tccaccaggg cggagaaggt cgagggcggc tggcggctca acggccagaa ggtctggaac      1560
     tcgatggccg aacgtgcgaa ctacggcatc tgcctggcca ggaccaatcc ggacgtcccc      1620
     aagcaccgcg gcatctcgta tttcctggtc gacatgaaga cgcccggcat cgacgtgcgc      1680
     ccgctgcgcg aggccaacgg caactacctg ttcaacgagg tcttcttcac cgacgtcctc      1740
     gtgcccgagg acaggatcgt cggcgagccc gacaagggct gggcactggc ccgcacgacg      1800
     ctcggcaacg aacgcgtggc gatgggcggc atgcgtgagc tgcgcatgga cctgcccgcg      1860
     ctcgccgcct ccggcgagct cgtgaccgat ccgggcgacg ttcgccgcga catcggcgcc      1920
     ctgtacgccc tcgcgttcgc gctgtcggcg atgtcgttgc gctccacgct gcgcaccctt      1980
     tccggcctgc ggcctggcgc cgaggcgagc gtcgcgaagg tggcggccag tttcctgaac      2040
     accgacgtgg ggacgcgtgt cctgcgctgg ttcggcccgt cggccgcgag tgccgacggt      2100
     ccggcggcgg cggccgtcca ccagtacctc agcatcccgc cgcacctgat cggcggtggc      2160
     accatcgaaa tccagctcaa tgtcatctcc gaacgtgttc tcggcctccc gcgcggctga      2220
//

If you have problems or comments...

PBIL Back to PBIL home page