(data stored in ACNUC7421 zone)

EMBL: CP002299.PE36

CP002299.PE36        Location/Qualifiers
FT   CDS_pept        complement(42802..42933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0036"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: saq:Sare_0018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78124"
FT                   /db_xref="UniProtKB/TrEMBL:E3J286"
FT                   /inference="similar to AA sequence:KEGG:Sare_0018"
FT                   /protein_id="ADP78124.1"
FT                   /translation="MMRRLALIAAVASAAALAARWRKDKSGQVDLWHEATSADQGGN"
     atgatgcgca ggcttgcgtt gatcgccgcg gtcgccagcg ccgccgcatt ggccgcccgc        60
     tggcgcaagg ataaaagcgg gcaggtcgac ctgtggcacg aggcgacctc cgccgaccag       120
     ggcggcaact ag                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page