(data stored in ACNUC7421 zone)

EMBL: CP002299.PE360

CP002299.PE360       Location/Qualifiers
FT   CDS_pept        complement(446966..447829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0362"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: mmi:MMAR_0140
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78448"
FT                   /db_xref="GOA:E3J8K5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8K5"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ADP78448.1"
FT                   /translation="MAFPTGVPIIDTMIGFPQPGTSQYDFIRRQLKDAESKEFAFPAEY
FT                   MFKNVPHDLPTDDPVSVTLHEMDRFGVEKGLIGCAGESARVALKKFPDRFVASGNINDP
FT                   NDVMGTVRAIVRDHEEYGIRAVGAFPSGTFPQVAINDEKMYPAYAKCVELGIAVFCCAG
FT                   VPGPRLKFEPQRVELIDQVMFDFPDLVFVTRHGCEPWTDLAVKLLLKWPNLYYSTSAFT
FT                   PKYYPKAIVDFANTRGADKILYAGYFPMGLTLERIMTDMPTVPFRDHVWPKFLHENARK
FT                   VLKLDA"
     atggcgttcc ccaccggagt cccgatcatc gacacgatga tcggcttccc gcagcccggc        60
     acctcgcagt acgacttcat ccggcggcag ctcaaggacg ccgagtccaa ggagttcgcc       120
     ttcccggccg agtacatgtt caagaacgtc ccgcacgacc tgccgaccga cgacccggtg       180
     agcgtcacgc tgcacgagat ggaccggttc ggcgtcgaga agggcctgat cgggtgcgcc       240
     ggcgagtccg cccgcgtcgc gctgaagaag ttcccggaca ggttcgtggc gagcggcaac       300
     atcaacgacc cgaacgacgt catgggcacc gtgcgcgcca tcgtccggga ccacgaggag       360
     tacggcatcc gggcggtcgg cgccttcccg tccgggacct tcccgcaggt cgcgatcaac       420
     gacgagaaga tgtacccggc gtacgcgaag tgcgtcgagc tgggcatcgc ggtgttctgc       480
     tgcgccgggg ttcccgggcc gcggctgaag ttcgagccgc agcgggtcga gctgatcgac       540
     caggtcatgt tcgacttccc cgacctcgtc ttcgtcaccc ggcacggctg cgagccatgg       600
     accgacctgg ccgtgaagct gctgctcaag tggccgaacc tgtactactc gacctccgcc       660
     ttcacgccga agtactaccc gaaggcgatc gtcgacttcg cgaacacccg cggcgcggac       720
     aagatcctct acgccgggta cttcccgatg ggcctcacgc tcgaacggat catgacggac       780
     atgccgaccg tgccgttccg cgaccacgtg tggccgaagt tcctgcacga gaacgcccgc       840
     aaggtcctca agctcgacgc gtaa                                              864
//

If you have problems or comments...

PBIL Back to PBIL home page