(data stored in ACNUC7421 zone)

EMBL: CP002299.PE361

CP002299.PE361       Location/Qualifiers
FT   CDS_pept        complement(448159..449565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0363"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; KEGG: fal:FRAAL6537
FT                   prolyl-tRNA synthetase; PFAM: Anticodon-binding domain
FT                   protein; tRNA synthetase class II (G H P and S)"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78449"
FT                   /db_xref="GOA:E3J8K6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8K6"
FT                   /inference="protein motif:TFAM:TIGR00408"
FT                   /protein_id="ADP78449.1"
FT                   /translation="MAVLTLRSDDFPRWYQDVIAKAELADNGPVRGSMVIRPYGYSLWE
FT                   RMQADVDARIKAAGAVNAYFPLFIPESYLRREAEHVEGFSPELAVVTHGGGKELEEPVV
FT                   VRPTSETVIGEYMAKWTQSYRDLPLLLNQWANVVRWELRPRLFLRTSEFLWQEGHTAHA
FT                   DGPDAAAYARRIALEVYQDFMVSVLAMPVFVGRKTRKERFAGAINTLTCEGMMGDGKAL
FT                   QMATSHELGQNFARAFDIDYLGADGARHLAWTTSWGSSTRMVGGLIMAHGDDAGLRVPP
FT                   RLAPTQVVVLPVRDDEKVVATATQIADALKAAGVRATLDARPGLSFGRRVTDWELKGAP
FT                   VRVEVGPRDLAVGNVTLARRDTGEKITVPLAEAAARVPALLDDVQAGLYQQALALRDSR
FT                   TADVTSLADAIEAAATGFARLPWRLVGDEGEARLAAESLTVRCIQNADGTLPTGTDDTD
FT                   DLVCLVARAY"
     gtggccgtac tgactcttcg ttccgacgac ttcccccgct ggtaccagga cgtgatcgcg        60
     aaggccgagc tggccgacaa cggtccggtc cgggggtcga tggtgatccg accgtacggc       120
     tactcgctct gggaacggat gcaggccgac gtcgacgccc ggatcaaggc ggccggcgcc       180
     gtcaacgcct acttccccct gttcatcccg gagagctacc tgcgccggga ggccgagcac       240
     gtcgaagggt tcagcccgga gctcgcggtc gtcacccacg gaggcggcaa ggagctggag       300
     gagccggtcg tcgtccgtcc gaccagtgag acggtcatcg gcgagtacat ggcgaagtgg       360
     acccagagtt accgcgatct gccgctacta ctcaaccagt gggcgaacgt cgtccgctgg       420
     gagctgcggc cgcggctgtt cctgcgtacc agcgagttcc tctggcagga gggccacacc       480
     gcgcacgcgg acggcccgga cgccgcggcc tacgcgcggc ggatcgcgct ggaggtctac       540
     caggacttca tggtctcggt gctggccatg cccgtcttcg tcgggcgcaa gacccgcaag       600
     gagcgcttcg ccggcgcgat caacaccctc acctgcgagg gcatgatggg tgacggcaag       660
     gcgctgcaga tggccaccag ccacgagctg ggccagaact tcgcccgcgc cttcgacatc       720
     gactacctcg gtgccgacgg cgcccgccac ctggcctgga ccacctcgtg gggctcgtcc       780
     acccggatgg tcggtgggct gatcatggcc cacggcgacg acgccggcct acgggtcccg       840
     ccgcggctcg ccccgaccca ggtcgtcgtg ctgccggtcc gggacgacga gaaggtcgtg       900
     gccacggcga cccagatcgc cgacgcgctg aaggccgcgg gcgtgcgggc cacgctggac       960
     gcccggccgg ggctgtcgtt cggccgtcgg gtcaccgact gggagctcaa gggtgcgccg      1020
     gtccgcgtcg aggtcggccc gcgtgacctg gccgtcggca acgtcaccct ggcccgccgc      1080
     gacaccggag agaagatcac cgtgccgctc gccgaggcgg cggcgcgcgt ccccgcgctg      1140
     ctcgacgacg tccaggccgg cctctaccag caggccctcg cgctgcgcga ctcccggacc      1200
     gccgacgtca cctcgctcgc ggacgcgatc gaggcggccg ccaccggctt cgcccggctg      1260
     ccctggcgcc tggtcggcga cgagggcgag gcgcgcctcg ccgccgagtc cctgaccgtg      1320
     cgctgcatcc agaacgccga cggcacgctg cccaccggca cggacgacac cgacgacctg      1380
     gtctgcctgg tggccagggc ctactga                                          1407
//

If you have problems or comments...

PBIL Back to PBIL home page