(data stored in ACNUC7421 zone)

EMBL: CP002299.PE370

CP002299.PE370       Location/Qualifiers
FT   CDS_pept        457854..459227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0372"
FT                   /product="VWA containing CoxE family protein"
FT                   /note="KEGG: stp:Strop_2018 VWA containing CoxE family
FT                   protein; PFAM: VWA containing CoxE family protein; SMART:
FT                   von Willebrand factor type A"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78458"
FT                   /db_xref="InterPro:IPR008912"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8L5"
FT                   /inference="protein motif:PFAM:PF05762"
FT                   /protein_id="ADP78458.1"
FT                   /translation="MSIPSVSSGPAASAGPAGSAEPELDPAASENRRQVLYWRLLARIF
FT                   APDEQPSLEAASLAIVEDLDLPAALLDPTVSIDNVVQRFPALAPEIDGLLAAPAADLPA
FT                   GSVGAAEVRTAAVMAKLLLNTFATGSGGVTAGQLADWQADAGWLRRTLGPDVGDGPGGP
FT                   GAVLGEIEADLVSRMHLREVLANPTLARRLTPSMSLIEQLLRDKDNLSGVALANAKALI
FT                   RRFVDEVAEVLRTQVEQTSAGTLDRSVPPKRVFRNLDLDRTIWKNLPNWSPEDQRLYVD
FT                   RLYYRQTARRTTPAKMIVVVDQSGSMVDSMVNCTILASIFAGLPRVDVHLIAYDTRALD
FT                   LTPWVNDPFEVLLRTKLGGGNDGPVAMEMARPKISDPRNTVMVWISDFYEFDRSQPLFE
FT                   AIESLHRGGVRFIPVGSVNSSGRGSVNPWFRERFKDLGTPVISGHIRKLVAELKNFVA"
     atgagcatcc cctccgtctc cagtgggcca gccgcctcgg cggggccagc cgggtcagcc        60
     gagccagagc tcgatccggc cgcgtccgag aaccgtcggc aggtgctcta ctggcggctg       120
     ctggcgcgga tcttcgcgcc ggacgagcag ccctcgctgg aggcggcgag cctcgcgatc       180
     gtcgaggatc tcgacctgcc ggcggcgctg ctggacccga ccgtgtcgat cgacaacgtc       240
     gtgcagcggt tcccggcgtt ggcccccgag atcgacggcc tgctcgccgc gccggcggcc       300
     gacctccccg cggggtcggt cggcgcggcg gaggtccgaa ccgccgcggt gatggcgaag       360
     ctactgctga acaccttcgc gaccggttcg ggaggtgtca cggccgggca gctcgccgac       420
     tggcaggctg acgccggctg gctgcggcgg acgctcgggc ccgacgtcgg cgacgggccc       480
     ggtggcccgg gcgctgtgct cggcgagatc gaggccgacc tggtgagccg gatgcacctg       540
     cgggaggtgc tggcgaatcc gacgctggcc cgccggttga ccccgagcat gtcgctgatc       600
     gagcagttgc tgcgcgacaa ggacaacctc tcgggtgttg cgctggcgaa cgcgaaggcc       660
     ctgatccgcc ggttcgtcga cgaggtcgcc gaggtgctgc gtacccaggt cgagcagacc       720
     agcgcgggca cgctcgaccg gtcggtgccg cccaagcggg tgttccgcaa cctcgacctc       780
     gaccggacga tctggaagaa cctcccgaac tggagccccg aggaccagcg cctctacgtc       840
     gaccgcctct actaccggca gaccgcccgg cgcaccacgc cggccaagat gatcgtcgtc       900
     gtcgaccagt ccggctcgat ggtcgactcg atggtgaact gcacgatcct ggcttcgatc       960
     ttcgccggcc tgcccagggt ggacgtccat ctgatcgcgt acgacacccg cgcgctcgac      1020
     ctcacaccct gggtgaacga cccgttcgag gtgctgctgc ggacgaagct cggcggtggc      1080
     aacgacggac ccgtcgccat ggagatggct cgtcccaaga tcagcgatcc acgtaacacc      1140
     gtgatggtgt ggatctcgga cttctacgag ttcgaccggt cccagccgct gttcgaggcg      1200
     atcgagtcgc tgcatcgcgg cggcgtccgg ttcatcccgg tcggctcggt gaacagctcc      1260
     ggccgcggca gcgtcaaccc atggttccgg gagcggttca aggacctggg cacgccggtg      1320
     atctcgggcc atattcgcaa gctcgtcgcc gagctcaaga acttcgtcgc ctga            1374
//

If you have problems or comments...

PBIL Back to PBIL home page