(data stored in ACNUC7421 zone)

EMBL: CP002299.PE374

CP002299.PE374       Location/Qualifiers
FT   CDS_pept        complement(464887..465966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0376"
FT                   /product="DNA integrity scanning, DisA, linker region"
FT                   /note="KEGG: fal:FRAAL6529 DNA integrity scanning protein
FT                   DisA; PFAM: DNA integrity scanning, DisA, linker region;
FT                   protein of unknown function DUF147; SMART:
FT                   Helix-hairpin-helix DNA-binding class 1"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78462"
FT                   /db_xref="GOA:E3J8L9"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8L9"
FT                   /inference="protein motif:PFAM:PF10635"
FT                   /protein_id="ADP78462.1"
FT                   /translation="MAGPPGDEAFRTTLAAVAPGTPFRDGLERILRGHTGALIVLGHDK
FT                   VVEGVCTGGFQLDVEFSATRLRELAKMDGAIVVSTDLNRIVRAAVHLVPDPTIPTEESG
FT                   TRHRTAERVARQTALPVISVSQSMRIIALYVGGRRYVLDDSAAILSRANQALATLERYK
FT                   QRLDEVAGTLSALEIEDLVTVRDAISVLQRLEMVRRIADEIEGYVVELGTDGRLLSLQL
FT                   EELMAGVETERELTVRDYQPVGAKVGSPAEVLTDLAAMSATDLLDLTALARALGFGSGA
FT                   DALDRQISPRGYRMLAKIPRLPRLIVDRLVDHFTTLQKLLAAGVDDLQAVEGVGETRAK
FT                   AVREGLSRLAESSILERYA"
     atggcaggac cacccgggga tgaggccttc cggaccacgc tcgccgcggt ggcgccggga        60
     accccctttc gggacggcct cgagcgcatc ctccgcggcc acaccggcgc gctgatcgtc       120
     ctcggccacg acaaggtcgt ggagggggtc tgcaccggcg gcttccagct ggacgtcgag       180
     ttctccgcga cccgcctgcg cgaactggcc aagatggacg gcgccatcgt cgtctccacc       240
     gacctgaacc ggatcgtgcg ggccgcggtc cacctggtgc ccgacccgac gatcccgacc       300
     gaggagtccg gcacccgcca tcgcaccgcc gaacgggtgg cccgccagac cgccctgccg       360
     gtgatctcgg tgagccagtc gatgcggatc atcgcgctgt acgtcggcgg ccgccgctac       420
     gtgctggatg actcggccgc gatcctctcc cgggcgaacc aggcgctggc gaccctggag       480
     cgctacaagc agcgcctcga cgaggtcgcg ggcacgctgt ccgcgctgga gatcgaggac       540
     ctggtcaccg tccgggacgc gatctcggtg ctgcagcgcc tcgagatggt ccgccggatc       600
     gcggacgaga tcgagggcta cgtcgtcgag ctcggcaccg acggccggct gctgtcgctc       660
     cagctcgagg agctgatggc cggcgtcgag accgagcgtg agctgacggt gcgcgactac       720
     cagcccgtcg gcgcgaaggt cggctccccg gccgaggtgc tcaccgacct ggccgcgatg       780
     tccgccaccg atctgctgga cctgacggcg ctggcccgcg cgctcggctt cggctcgggc       840
     gcggatgccc tggaccgcca gatcagcccc cggggctacc ggatgctcgc caagatcccc       900
     cgcctgcccc ggctgatcgt cgaccgcctg gtcgaccact tcaccacgct gcagaagctg       960
     ctagccgccg gtgtcgacga cctccaggct gtcgagggcg tgggcgagac ccgcgccaag      1020
     gccgtccgcg aaggcctgtc ccgcctggcc gaatcctcca tcctggagcg ctacgcctag      1080
//

If you have problems or comments...

PBIL Back to PBIL home page