(data stored in ACNUC7421 zone)

EMBL: CP002299.PE375

CP002299.PE375       Location/Qualifiers
FT   CDS_pept        complement(466272..467795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0377"
FT                   /product="DNA repair protein RadA"
FT                   /note="TIGRFAM: DNA repair protein RadA; PFAM: Circadian
FT                   clock protein KaiC central region; KEGG: fal:FRAAL6528 DNA
FT                   repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78463"
FT                   /db_xref="GOA:E3J8M0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M0"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ADP78463.1"
FT                   /translation="MSDPTATVSGMAVVGSSGNASASGSGSASRRAAGGASGRSRADGG
FT                   FRCSECGAESIRWAGRCPRCQAWSTLEAQKAPPRRAAVAGSGATAPATVTTPAKPVTEV
FT                   DPSPAARRSTGVDELDRVLGGGVVPGAVILLAGEPGVGKSTLLLEVAARSAQAGHRALV
FT                   VTGEESVAQVRLRAGRTGTLHADLWLAAETDLGALLGHVEEVQPTLLVVDSVQTISAAG
FT                   VDGVAGGVTQVREVAAALIRAAKALGLATILVGHVTKDGSVAGPRLLEHLVDVVLHFEG
FT                   DQQTALRMIRSVKNRYGPTDEVGCFEMNENGIWGIADPSGLFLSRGATASAVPGVCVTV
FT                   MVEGRRPLVAEVQALVAPQSYGRGGAGAPAPPPPRRAVSGLDGSRVAMITAVLQKRSGF
FT                   GMLGGADIFTASVGGVKLHEPAADLAVALAMVSSAQDRGVPSDLIALGEVGLTGEIRSV
FT                   SGIERRLAAAARLGFRRALVPRLSGLVPEGMTVTEATDLNAAIANMYDG"
     atgtcggacc cgacggctac ggtcagcggc atggcggttg tgggttccag cggcaatgcg        60
     tcggccagcg gcagtgggtc ggcgagcagg cgggcggccg gcggcgcgtc cggccggtcg       120
     cgggccgacg gcggcttccg ctgcagcgag tgcggggccg agtcgatccg gtgggccggg       180
     cgatgcccgc gctgccaggc gtggagcacg ctcgaggcgc agaaggcccc gccgcgccgg       240
     gccgccgtcg cgggttctgg cgcgaccgcc ccggcgacgg tgacgacgcc ggccaagccg       300
     gtcaccgagg tcgacccgtc gcccgccgcc cgcagatcga ccggggtcga cgagctcgac       360
     cgggtgctcg gcggtggcgt ggtccccggc gccgtcatcc tgctcgccgg cgagcccggg       420
     gtcggcaagt cgacgctgtt gctggaggtc gcggcgcgca gtgcccaggc cggccaccgg       480
     gccctcgtcg tcaccggtga ggagtctgtc gcccaggtgc ggctacgggc cgggcgcacg       540
     ggcaccctgc acgccgacct gtggctcgcg gccgagaccg acctcggcgc gctgctcggt       600
     cacgtcgagg aggtccagcc gacgctgctg gtcgtcgact cggtgcagac gatctccgcc       660
     gcaggggtgg acggtgtcgc cggaggcgtc acgcaggtcc gcgaggtcgc ggcggcgctg       720
     atccgcgcgg ccaaggcact gggcctggcg acgatcctgg tcgggcacgt gacgaaggac       780
     ggctcggtgg ccgggccgcg gctgttggag cacctcgtcg acgtggtgct gcatttcgag       840
     ggtgaccagc agaccgccct tcggatgatc cgttccgtca agaaccggta tgggccgacc       900
     gacgaggtcg gctgcttcga gatgaacgag aacgggatct ggggcatcgc cgatccgagc       960
     gggctgttcc tgtcccgggg cgcgacggcg agcgccgtgc ccggcgtctg cgtgacggtc      1020
     atggtggagg gacgcaggcc tctggtcgcg gaggtgcagg cgctggtggc accgcagagc      1080
     tacgggcgcg ggggcgcggg cgcgcccgcg cccccgccgc ccaggcgggc cgtctccggg      1140
     ctcgacggct ccagggtcgc gatgatcacc gcggtgctgc agaagcgctc gggcttcggg      1200
     atgctcggcg gcgcggacat cttcaccgcg tcggtcggag gggtgaagct gcacgagccg      1260
     gccgccgacc tggccgtcgc gctggccatg gtgagctccg cccaggaccg aggcgtcccg      1320
     tcggacctca tcgccctcgg cgaggtcggg ctgaccggcg agatccgctc ggtcagcggc      1380
     atcgagcgcc gcctcgccgc cgccgcgcgt ctcgggttcc gccgcgcgct cgtccctcgc      1440
     ctgtccgggc tggtcccgga gggcatgact gtcaccgagg cgacagatct caatgccgcg      1500
     atcgcgaaca tgtacgacgg atag                                             1524
//

If you have problems or comments...

PBIL Back to PBIL home page