(data stored in ACNUC7421 zone)

EMBL: CP002299.PE376

CP002299.PE376       Location/Qualifiers
FT   CDS_pept        complement(468027..468773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0378"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: fal:FRAAL6527 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78464"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M1"
FT                   /inference="similar to AA sequence:KEGG:FRAAL6527"
FT                   /protein_id="ADP78464.1"
FT                   /translation="MSRRLGARSIAFPRRPVVSPALPTSPAVAAMHGQTREGAAAHPLR
FT                   RGAVMLAAAALLGAPALAACASGNDAMTNLARTTTNTANGAVGTINLRNVYVAGPVSQG
FT                   GDAQVISALFNGGSQDDALVAISSPDATGGTPGSPATLAPAGGQIYIANGSAPTLTGLK
FT                   KNLPIGTATKVTFTFAKAGAVTLDVPVEAPLPGASAAPSVTAAATTAAATPTATGTALT
FT                   GVTPTAGASATTGLVPTVAPTVTATP"
     gtgagccgcc gtctgggggc gcgcagcata gccttcccgc gccgtcccgt cgtttcgccc        60
     gccctgccca cctcgcccgc cgtcgcggcc atgcacggcc agacacggga gggggccgcg       120
     gcccatccgt tgcggcgtgg cgcggtgatg ctggccgccg ccgcgctgct cggcgctccc       180
     gcgctcgcgg cgtgcgccag cggcaacgac gcgatgacga acctcgcgcg cacgacgacg       240
     aacaccgcca acggtgccgt cggcacgatc aacctgcgca acgtctacgt ggccggcccg       300
     gtcagccagg gcggcgacgc ccaggtgatc tccgccctgt tcaacggcgg aagccaggac       360
     gacgcgctgg tcgccatctc gtcgccggac gcgaccgggg gcaccccggg cagcccggcg       420
     accctggcgc cggccggcgg ccagatctac atcgccaacg gctcggcccc gacgctgacc       480
     ggcctgaaga agaacctgcc gatcggcacc gcgaccaagg tgaccttcac gttcgccaag       540
     gcgggcgccg tcaccctgga cgtgccggtc gaggcaccgc tgccgggcgc gtccgccgcg       600
     ccgtcggtga ccgccgcggc caccaccgcg gccgcgaccc cgacggcaac cgggacggcc       660
     ctcacgggcg tgacgccgac cgccggcgcc tcggcgacga ccgggctcgt cccgaccgtc       720
     gcgccgacgg tcaccgccac tccctga                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page