(data stored in ACNUC7421 zone)

EMBL: CP002299.PE380

CP002299.PE380       Location/Qualifiers
FT   CDS_pept        472575..472967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0382"
FT                   /product="putative F420-dependent enzyme"
FT                   /note="KEGG: fal:FRAAL6522 hypothetical protein; TIGRFAM:
FT                   putative F420-dependent enzyme; PFAM: pyridoxamine
FT                   5'-phosphate oxidase-related FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78468"
FT                   /db_xref="GOA:E3J8M5"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019920"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M5"
FT                   /inference="protein motif:TFAM:TIGR03618"
FT                   /protein_id="ADP78468.1"
FT                   /translation="MGERLPEKVRTLADAPTYVTLATLQSDGSPRLTVLWIERDGDDLL
FT                   LSTVRGRAKERDIDRDPRVALMFLDQHDPYSYVEIRGTATLTEEGGRDLIDRLAVKYTG
FT                   EPYKWDGPDAIRVVIRISPTRVLTTG"
     atgggtgaac ggctgccgga aaaggtcagg acgctggcgg acgcgccgac ctacgtgacc        60
     ttggcgacgt tgcagtcgga cgggtcacca cggcttacgg tgctgtggat cgagcgggac       120
     ggcgacgacc tgttgctctc gacggtgcgc ggccgggcca aggagcgcga catcgaccga       180
     gatccgcgcg tcgccctcat gttcctcgac cagcacgacc cgtattccta cgtggagatc       240
     cgcggcacgg cgaccctgac cgaggagggc ggccgcgacc tgatcgaccg cctggccgtc       300
     aagtacaccg gcgagcccta caagtgggac ggcccggacg ccatccgcgt ggtcatccgc       360
     ataagcccca cccgcgtcct caccaccggc tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page