(data stored in ACNUC7421 zone)

EMBL: CP002299.PE381

CP002299.PE381       Location/Qualifiers
FT   CDS_pept        473179..474699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0383"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="SMART: Cysteinyl-tRNA synthetase class Ia DALR;
FT                   TIGRFAM: cysteinyl-tRNA synthetase; KEGG: fal:FRAAL6521
FT                   cysteinyl-tRNA synthetase; PFAM: Cysteinyl-tRNA synthetase
FT                   class Ia; Cysteinyl-tRNA synthetase class Ia DALR"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78469"
FT                   /db_xref="GOA:E3J8M6"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M6"
FT                   /inference="protein motif:TFAM:TIGR00435"
FT                   /protein_id="ADP78469.1"
FT                   /translation="MSLHLYDTRTRRVRPFEPLRPGHVGVYVCGPTVQSAPHVGHLRSA
FT                   VAFDLLRRWLLESGYAVTYVQNVTDIDDKIIVNADREGVSVWELATRETRSFDDAYRAV
FT                   GILPPTIQPRATGHIPEMFALIGELMAAGYAYEGDGSVWFRVGRFGDYGALSNQRPDAM
FT                   QASAEVEAGKEDPRDFALWKAARPGEPAWDSPWGSGRPGWHLECSAMAGKYLGDVFDIH
FT                   GGGLDLVFPHHENERAQTVCASAARAHDGSGEPEMARYWMHVGLLTTGGTKMSKSLGNS
FT                   FFVTDALAQVRPQVLRYHLLSAHYRSSLEYSPDALAESAAGYGRVETFVRNALDILGSP
FT                   EEAASLAAEASPAAAPRPAKSRGKGRPQGRAAAGPAGTASPAAAWAAFSAALDDDLGVS
FT                   RALAALFGAVAEGNLVLSKTHRGELAGWLVVVRRMLTVLGLDPVKQWPAAGGQVRAALD
FT                   GVMEIVRDLRSSARARLDYAEADSIRDRLRDAGIIVDDTGEGQRWHLA"
     atgagcctgc acctctacga cacgcgtacg cggcgcgtgc ggccttttga gccgctgcgc        60
     cccggccacg tgggcgtcta cgtgtgtggg ccgaccgttc agtccgctcc gcacgtcggc       120
     catctgcgtt cggcggtcgc gttcgacctg ctgcgacgct ggctgctcga gtccggctac       180
     gccgtcacct acgtgcagaa cgtcacggac atcgatgaca agatcatcgt caacgcggac       240
     cgggaaggcg tctcggtctg ggagctcgcg acccgggaga ccaggtcgtt cgacgacgcc       300
     taccgggccg tcggcatcct gccgccgacg atccagcccc gcgcgaccgg ccacatcccg       360
     gagatgttcg ccctgatcgg cgagctgatg gcggcgggct acgcctacga gggcgacggg       420
     tccgtgtggt tccgggtcgg ccggttcggc gactacggcg ctctgtccaa ccagcggccg       480
     gacgccatgc aggcctcggc ggaggtcgag gcgggcaagg aggacccgcg cgacttcgcg       540
     ctgtggaagg cggcgaggcc gggcgagccg gcctgggact cgccgtgggg ctccgggcgg       600
     cccggctggc acctcgagtg ctcggcgatg gccggcaagt acctgggtga cgtcttcgac       660
     atccacggcg gcgggctgga cctcgtgttc ccgcatcacg agaacgaacg ggcgcagacg       720
     gtctgcgcgt ccgcggcgcg ggcccatgac gggtcaggcg agccggagat ggcccggtac       780
     tggatgcacg tcgggctgct gaccaccggt ggcacgaaga tgtccaagtc gctgggcaac       840
     tcgttcttcg tgaccgatgc gctggcccag gttcgcccgc aggtgctgcg ctaccacctg       900
     ttgtcggcgc actaccgctc gtcgttggag tacagccccg acgcgctcgc cgagtcggcc       960
     gccgggtacg gccgggtgga gaccttcgtc cgcaacgccc tggacatcct cggcagcccg      1020
     gaggaggccg cctcgctcgc cgcggaggca tcgcccgcgg ccgcgccgcg cccggccaag      1080
     agccggggaa agggccggcc gcagggccgg gccgctgccg ggccagctgg cacggcgtct      1140
     ccggcggcgg cctgggcggc cttctccgcc gcgctggacg acgacctcgg ggtcagccgt      1200
     gcgctcgccg cgctgttcgg ggccgtggcc gaggggaacc tcgtgctgtc gaagacccac      1260
     agaggggagc tcgccggttg gctggtcgtc gtccgccgga tgctgaccgt cctcgggctc      1320
     gacccggtga agcagtggcc ggccgccggt ggccaggtgc gcgcggcgct ggacggcgtc      1380
     atggagatcg tgcgggacct gcgttcgtcg gcccgggccc gcctcgacta cgccgaggcc      1440
     gactcgatcc gcgaccgcct gcgcgacgcc ggcatcatcg tcgacgacac cggcgagggc      1500
     caacgctggc acctcgcctg a                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page