(data stored in ACNUC7421 zone)

EMBL: CP002299.PE382

CP002299.PE382       Location/Qualifiers
FT   CDS_pept        complement(474775..476109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0384"
FT                   /product="Forkhead-associated protein"
FT                   /note="KEGG: fal:FRAAL6520 hypothetical protein; PFAM:
FT                   Forkhead-associated protein; SMART: Forkhead-associated
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78470"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M7"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ADP78470.1"
FT                   /translation="MSARCPEGHLSQDPDYCDQCGLRITSGQDSYGYRSDDRGAPVGSY
FT                   GGGSGRGGGGGGTGAGYDPLGIRRGGEPAGRGTPRGGDPYGGEQYDSGFGAGYDDRPAR
FT                   SSYGADSYDQSGYGSPRGGRDGRAAEGFEGREAGGARGGRDDPDAGYGRGGRDGGGRGA
FT                   PADADGYQSSRGGRDDFGGRGGDQYGRDGGETAYARGGRDDRDGYGGGRGGRDAAAGDG
FT                   GRGYDSDPLGVADRGGARAAGRYPQCPNCRAYYEPGARFCENCGLDFTTGHMPGAGPAG
FT                   SGRRQTDPPVDGGYGEPVITGNAANWNGGGGAPVATTWEAVVEAERDYYDSGDDHRVPF
FT                   PSFYPRRVFPLSGPRLLVGRRSESRGIHPEIDLSGAPEDPGISRAHAVFERQPDGGYAL
FT                   LDPGSTNGTRLNDEPEPIEPHGPVPLQDGDRVYLGAWTRITIRAR"
     gtgagcgcac gctgcccgga ggggcacctg tcccaggatc ccgactactg cgatcagtgc        60
     ggcctccgca tcacgagtgg tcaggacagt tacggctacc ggtctgacga ccgtggcgcg       120
     cccgtcggct cctacggggg cggctcgggt cgcggcggcg gcggcggtgg cactggtgcc       180
     gggtacgacc ccctaggcat ccgtcgcggg ggtgagccag ccggtcgcgg tacgccgcgc       240
     ggcggcgacc cgtacggcgg ggagcagtac gacagcggtt tcggagccgg ctatgacgac       300
     cgcccggcgc ggtcgtccta cggcgccgat tcctacgacc agagcggcta cgggtcgcct       360
     cggggcggcc gggatggccg cgccgccgag ggcttcgagg gccgggaggc cggcggagcc       420
     cgcggtgggc gggacgaccc ggacgccggc tatggccgtg gcggccgcga cggcggtggg       480
     cgcggcgctc ccgccgatgc cgacgggtac cagtcatcgc gcggcggccg ggacgacttc       540
     ggcggccgtg gcggcgacca gtacggccgt gacggcggcg agaccgccta cgcgcgcggc       600
     ggccgggacg accgtgacgg ctacggcggc gggcgcggcg gccgggacgc ggcggccggc       660
     gacggcggac gcggctacga ctccgacccg ctcggcgtgg ccgaccgggg tggtgcccgc       720
     gcggccggcc ggtacccgca gtgcccgaac tgccgtgcct actacgagcc cggcgctcgg       780
     ttctgcgaga actgcggcct ggacttcacc accgggcaca tgccgggtgc cggcccggcc       840
     gggtccggcc gccgccagac cgacccaccg gtcgacggcg gttacggcga gccggtcatc       900
     accgggaacg cggccaactg gaacggtgga ggcggcgcac cggtcgcgac cacctgggag       960
     gccgtcgtcg aggccgagcg ggactactac gacagcggcg acgaccaccg ggtcccgttc      1020
     ccgtcgttct acccgcgccg ggtgttcccg ctgtccgggc cgcggctgct ggtcggccgg      1080
     cgcagcgagt cccgcggcat ccacccggag atcgacctgt cgggcgcccc ggaggacccg      1140
     ggtatctcgc gcgcgcacgc ggtcttcgag cggcagccgg acggcggcta cgcgctgctg      1200
     gacccgggct cgaccaacgg cacccggctg aacgacgagc cggagccgat cgagccccac      1260
     gggccggtcc cgctgcagga cggcgaccgc gtctacctgg gcgcctggac ccgcatcacc      1320
     atccgcgccc gttag                                                       1335
//

If you have problems or comments...

PBIL Back to PBIL home page