(data stored in ACNUC7421 zone)

EMBL: CP002299.PE383

CP002299.PE383       Location/Qualifiers
FT   CDS_pept        complement(476420..477568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0385"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="KEGG: fal:FRAAL6518 hypothetical protein; PFAM:
FT                   Protein phosphatase 2C-like; SMART: protein phosphatase 2C
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78471"
FT                   /db_xref="GOA:E3J8M8"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M8"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /protein_id="ADP78471.1"
FT                   /translation="MTVEHDAAGSYDVGGSGYHGGSYDGGSGYDLPERGMPERGRSLID
FT                   ERTNRCPRCAVVLYGDARYCDSCGFALQGPPVVSGDSDHREKDLGQIAGVCDRGVRHAT
FT                   NEDAMGVAEVFGTMIAVVCDGVSTTPGSGEASAAAAATATTILADAVRAHGPGRAVPVG
FT                   RPGDVLDVLEPGDEDDYHDPVTLPAAVVGGFGPEEAELALHHAVHAAQDMIAQLSAAEG
FT                   RMAPSCTIAAAIISPPVAGGPRTVTIGWVGDSRVYLLGPRWSERLSADDTWAAEAARAG
FT                   LIPASEAETHRRAHTLTRWLGGDAEDVAPHTAVFPIEAPATILVCSDGLWNYASRPDVM
FT                   AAIVNQLPPDATAVEVGRHLIEFAIDQGGHDNITVITARVDR"
     atgaccgtgg agcacgacgc cgctggaagc tacgacgtcg gcggatccgg ctatcacggc        60
     gggtcttacg acggcgggtc cggctacgac ctgcctgaac gcggcatgcc ggagagagga       120
     cggtccctga tcgacgagcg cacgaaccgc tgcccgcgct gcgccgtcgt cctctacggc       180
     gacgcgcggt actgcgactc ctgcggcttc gcgctgcagg gcccaccagt ggtcagcggc       240
     gactcggatc accgggagaa agacctcgga cagatcgccg gggtctgcga ccgcggcgtc       300
     cggcacgcca ccaacgagga cgccatgggc gtcgccgagg tgttcgggac gatgatcgcc       360
     gtcgtctgcg acggcgtgtc gacgacgccg ggctccggcg aggcgtcagc ggccgcggcc       420
     gcgacggcga ccacgatcct ggccgacgcg gtgcgcgcgc acggcccggg ccgggcggtc       480
     ccggtcggcc ggcccggtga cgtgctcgac gtcctggaac cgggagacga ggacgactac       540
     cacgacccgg tgacgctgcc ggccgcggtc gtcggcggct tcggcccgga agaggcggag       600
     ctggcgctgc accacgcggt gcacgcggcc caggacatga tcgcccagct cagcgcggcg       660
     gagggccgga tggcaccgtc gtgcacgatc gccgcggcca tcatctcgcc gccggtcgcg       720
     ggcggcccca ggacggtgac catcggctgg gtcggcgaca gccgggtgta cctgctgggc       780
     ccacgctggt cggagcggct gtccgcggac gacacctggg cggcggaggc ggcccgcgcc       840
     ggcctcatcc cggcctccga ggccgagacc caccgcaggg cgcacacgtt gacccgttgg       900
     ctcggcggcg acgccgagga cgtggccccg cacacggccg tcttcccgat cgaggcgccc       960
     gcgacgatcc tggtctgcag cgacggcctg tggaactacg cgtcccggcc cgacgtcatg      1020
     gcggccatcg tcaaccagct gccaccggac gccacggccg tcgaggtcgg gcgccacctc      1080
     atcgagttcg cgatcgacca gggtgggcac gacaacatca ccgtgatcac ggcacgcgtg      1140
     gaccgttga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page