(data stored in ACNUC7421 zone)

EMBL: CP002299.PE384

CP002299.PE384       Location/Qualifiers
FT   CDS_pept        478266..479366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0386"
FT                   /product="RNA methyltransferase, TrmH family, group 3"
FT                   /note="KEGG: fal:FRAAL6517 tRNA/rRNA methyltransferase;
FT                   TIGRFAM: RNA methyltransferase, TrmH family, group 3; PFAM:
FT                   tRNA/rRNA methyltransferase (SpoU); RNA 2-O ribose
FT                   methyltransferase substrate binding"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78472"
FT                   /db_xref="GOA:E3J8M9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8M9"
FT                   /inference="protein motif:TFAM:TIGR00186"
FT                   /protein_id="ADP78472.1"
FT                   /translation="MARGGQGGRAAKAGSHRKGASIGSGGQRRRALEGKGATPPAEMRK
FT                   GHPAQRRANAAARSETTSTRAGSTARPTGARDGGPARAGHTGQRDGGPARAGNTGQRDG
FT                   AATGRGGPAGRRPGETDELVVGRNAVVEALRAGIPAATLYVAGGLEFDERLTEARKLAG
FT                   RAGMAVVDIGRFELDRLCGVAPHQGLALVVPPFRYAHPDDLLARARASDPGLLVALDGV
FT                   TDPRNLGAVVRSAAAFGAQGVVVPERRAAGMTAAAWKTSAGAAARLPVARATNLNRTLR
FT                   SYADGGLVVVGLAANADVSLDDLAAATDPIVLVIGSEGRGLSRLVGENCDLLVRIPMAG
FT                   EVESLNAGVAAGVALAEIARRRRQTS"
     gtggcgcgcg gcggccaggg cggccgggcg gcgaaggccg gctcgcaccg caagggcgcg        60
     tcgatcggaa gcggtggcca gcggcgccgg gctctggaag gcaagggcgc gacgccgcca       120
     gccgagatgc gcaagggcca cccggcgcag cggcgcgcga acgcggcggc gcggtccgag       180
     accacgagca cccgtgccgg gtcgaccgcg cggccaaccg gtgcccgcga cggtggtccg       240
     gcgcgggccg gccacacggg tcagcgtgac ggtggtccgg cgcgggcggg caacaccggt       300
     cagcgcgacg gggccgccac cggtcgcggc gggccggctg gccggcgccc cggggagacc       360
     gacgagctcg tcgtcgggcg taacgcggtc gtcgaggcgc taagggccgg tatcccggcc       420
     gcgacgctgt acgtcgccgg aggacttgag ttcgacgagc gcctgaccga ggcccgcaag       480
     ctcgccggcc gagccggcat ggcggtcgtg gacatcggcc gcttcgagct ggaccgcctc       540
     tgcggggtgg cgccgcacca ggggctcgcg ctggtggtcc cgccgttccg gtacgcgcac       600
     cccgacgacc tgttggcgcg ggcgcgggcg agcgaccctg gcctgctggt cgcgctcgac       660
     ggggtgaccg acccgcgcaa cctcggcgcc gtcgtccgct ccgccgccgc gttcggggcg       720
     cagggcgtcg tcgtgcccga gcggcgcgcc gccgggatga ccgcggcggc ctggaagacc       780
     tccgccggag ccgcggcgcg gctgccggtg gcccgggcca ccaacctgaa ccggacgctg       840
     cggtcgtacg ccgacggcgg cctggtcgtc gtcgggctcg ccgcgaacgc ggacgtcagc       900
     ctcgacgacc tggcggccgc gaccgacccg atcgtgctcg tgatcggctc ggagggtcgt       960
     ggcctgtccc ggctggtcgg ggagaactgc gatctgctgg tccggattcc gatggccggc      1020
     gaggtcgagt cgctcaacgc gggggtcgcg gccggcgtcg ctctcgccga gatcgcgcgc      1080
     cgccgccgcc agacgtcctg a                                                1101
//

If you have problems or comments...

PBIL Back to PBIL home page