(data stored in ACNUC7421 zone)

EMBL: CP002299.PE388

CP002299.PE388       Location/Qualifiers
FT   CDS_pept        complement(482124..483131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0390"
FT                   /product="Acetamidase/Formamidase"
FT                   /note="PFAM: Acetamidase/Formamidase; KEGG: kfl:Kfla_6883
FT                   acetamidase/formamidase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78476"
FT                   /db_xref="GOA:E3J8N3"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8N3"
FT                   /inference="protein motif:PFAM:PF03069"
FT                   /protein_id="ADP78476.1"
FT                   /translation="MEVVEFRPRPAQFAWTFGGVAPIRTVKPGTVLRLWTEDAFGGRLR
FT                   TTSDLPSSSLTMPFVNPQTGPFYVEGAEPGDTLVLHLVELTPARGWGASSTIPFFGGLT
FT                   GTDRTATLAPPLPERTWIYEVDRAKSTVTFTALSSEFQVDLPMSPMLGTVGVAPAAMEA
FT                   RSALVPDRFGGNMDTPEMRAGATCYLGVNVDGALFSIGDGHYRQGEGEACGTAVEGAMD
FT                   VTLIVELVKGRAPQWPRLESDTHFITVGSSRPLEDAWRIGQVEMVTWLSELYGLETLDS
FT                   YQLLSQISEAPLANVVDVNYSALAKIAKAYLPPVAAYDGMHRYLRDLAARIPPL"
     gtggaggtcg tcgagttccg gccgcggccc gcgcagttcg cgtggacctt cggcggggtg        60
     gccccgatcc ggacggtgaa gccgggcacc gtgctgcggc tgtggaccga ggacgccttc       120
     ggtgggcgcc tgcgcacgac ctccgacctg ccgagcagtt cgctgacgat gccgttcgtc       180
     aacccacaga cggggccgtt ctacgtcgag ggcgccgaac ccggcgacac gctcgtgctg       240
     cacctggtcg agctcacccc ggcccgaggc tggggcgcgt cgtcgacgat cccgttcttc       300
     gggggcctga ccggcacgga ccgcaccgcc acgctcgcgc cgccgttgcc ggaacgcacc       360
     tggatctacg aggtcgaccg ggcgaagagc acggtcacat tcaccgctct gtccagcgag       420
     ttccaggttg atctgccgat gtcacccatg ctgggcaccg tcggcgtcgc accggccgct       480
     atggaggcca gatcggcgct ggtcccggac cggtttggcg ggaacatgga caccccggaa       540
     atgcgggccg gcgcgacctg ctatctcgga gtcaacgtcg atggggcgct gttctccatc       600
     ggagatgggc actaccggca gggtgaaggc gaggcctgcg gcacggctgt agaaggcgcc       660
     atggacgtga ccctgatcgt ggagctcgtc aaaggccggg cgccacaatg gccgcggctg       720
     gaaagcgaca cgcacttcat caccgtcggc tcaagccggc cgttggagga cgcctggcgg       780
     atcggccagg tggagatggt cacctggctg tcggagctgt acgggctgga gacgctcgac       840
     agttaccagt tgctcagcca gatcagcgag gccccgctgg ccaacgtggt cgacgtcaac       900
     tacagcgcac tcgccaagat cgccaaggcc tacctgccgc cggtcgccgc ctacgacggg       960
     atgcaccgct atctccgcga cctcgcggcg cggatcccgc cgctctga                   1008
//

If you have problems or comments...

PBIL Back to PBIL home page