(data stored in ACNUC7421 zone)

EMBL: CP002299.PE391

CP002299.PE391       Location/Qualifiers
FT   CDS_pept        486229..487755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0393"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   cwo:Cwoe_3300 drug resistance transporter, EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78479"
FT                   /db_xref="GOA:E3J8N6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8N6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ADP78479.1"
FT                   /translation="MVVESRVAVSTASASTVTRAEAMESRAVDPSVMESSAGAAAGRTA
FT                   RFGASAQYALLAGPLLTMLDSSIVNVAVEPISRQTHTSLPTVQWIISGYLLALGAGLAL
FT                   TSYLARRFGTIPAYTGFLAAFTVTSALCAAAPGTGVLIAARVLQGLAGAPLVPLAMSML
FT                   LGGSGGAKSRMSPAAGILLFLGPALGPSLGGLLLGAVSGGDGWRVLFLINVPIGALAIA
FT                   AARRLPAGVSPPPQPAARPDPVGLLLLVAGLVGVLYGVDRITRGSWTPPMTWGPVIGGV
FT                   VVLVLYTLRSRSVEHPALDLSILRDRSVALAFTLCGTASVAAWSIVFVVPVFLESAQGH
FT                   SALMTGVALLPQGIVTGLSTLAGASAGEKIGVRPTVLGGFALLVVASAGLFVLGDQTPL
FT                   WLTALILAARAGAVGLTITPLVLVATEPLRPEQQADANTAFNVVQRILGSFGIGLVATL
FT                   FTRRSAHAGAVPALHTVALVITVLAGLSTFAAFYLPRPRRSGDVSPVALH"
     gtggtcgtgg agtccagagt ggcggtatcc acggcgtcgg cgtccacggt gacgagggcc        60
     gaagcaatgg agtcaagagc ggtggatccc agcgtgatgg agtccagcgc gggcgcggcg       120
     gcgggccgga ccgctcggtt cggcgcgagc gcgcagtatg cgctgctggc gggcccgctg       180
     ctgacgatgc tcgactcgtc gatcgtcaac gtggccgtcg agccgatctc ccgccagacc       240
     cacacgtcgc tgccgacggt ccagtggatc atcagcggct acctgctcgc cctcggcgcc       300
     gggctcgcgc tcacctcgta tctggcccga cggtttggca ccattcccgc ctacaccggg       360
     ttcctcgccg cgttcaccgt gacgtcggcg ctgtgcgcgg ccgcgccggg cacgggtgtc       420
     ctcatcgccg cccgggtgct gcagggcctg gccggggcgc cgctcgtccc gttggcgatg       480
     tcgatgctgc tcggtggatc cggcggggcg aagagccgga tgtccccggc ggccggcatc       540
     ctgctcttcc tcggcccggc gctgggcccg agcctcggcg gcctgctgct gggcgccgtg       600
     agcggcgggg acggctggcg ggtgctgttc ctgatcaacg tgccgatcgg cgcgctggcc       660
     atcgccgcgg cccgccggct gccggccggc gtcagccccc cgccgcagcc cgctgcccgg       720
     cccgacccgg tcggactgct cctgctcgtc gccgggctgg tcggcgtgct ctacggcgtc       780
     gaccgcatca cccggggctc gtggacgccg cccatgacct ggggtccggt gatcggtggc       840
     gtggtcgtcc tcgtcctcta cacgctgcgg tcgcgcagcg tggagcaccc cgcgctcgac       900
     ctctcgatcc tgcgcgaccg cagcgtggca ctggcgttca cgctgtgtgg gacggcgtcg       960
     gtggcggcgt ggtcgatcgt gttcgtcgtg ccggtcttcc tcgagtcggc gcagggccac      1020
     tccgcgctga tgaccggcgt cgcgctgctg ccgcagggga tcgtgaccgg gctgagcacg      1080
     ctggccggcg cgagcgctgg cgagaagatc ggcgtccggc cgaccgtgct cggtggcttc      1140
     gcgttgctgg tggtggcgag cgccgggctg ttcgtcctcg gcgaccagac cccgctgtgg      1200
     ctcaccgcgc tgatcctcgc ggcccgcgcg ggagcggtcg gcctcaccat caccccgctg      1260
     gtgctggtgg cgaccgagcc gttgcggccg gagcagcagg cggacgcgaa caccgcgttc      1320
     aacgtcgtgc agcgcatcct cgggtcgttc gggatcggtc tcgtcgcgac cctgttcacc      1380
     cggcggtccg cccacgctgg agcggttccg gcgctgcaca cggttgccct ggtcatcacg      1440
     gtgctcgccg gcctctcgac gttcgccgcc ttctacctcc ctcggccgcg ccgctcaggc      1500
     gacgtcagtc ctgtcgcgct gcactag                                          1527
//

If you have problems or comments...

PBIL Back to PBIL home page