(data stored in ACNUC7421 zone)

EMBL: CP002299.PE393

CP002299.PE393       Location/Qualifiers
FT   CDS_pept        complement(488824..489156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0395"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: sro:Sros_6088 transcriptional regulator protein-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78481"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8N8"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ADP78481.1"
FT                   /translation="MTEPAFFVLTALVGAPRHGYGIVGEVRDLSQGRVQLKVGTLYGVL
FT                   ERLVADGLVALDREEIQQGRLRRYYRLTEPGSEALAAEAGRQEANAQVASRRLRALRPA
FT                   GTGGSA"
     atgaccgagc ccgccttctt cgtcctgacc gcgctggtcg gggcgcccag gcacggctac        60
     ggcatcgtcg gcgaggtcag ggacctctcc cagggcaggg tgcagctcaa ggtaggcacg       120
     ctctacgggg tgctggaacg cctcgtcgcc gacggtctgg tcgcgctgga ccgggaagag       180
     atccagcagg gcaggctgcg ccgctactac cggctgaccg agccgggcag cgaggcgctg       240
     gcggcggagg ccggccggca ggaggccaac gcgcaggtcg cctcgcgacg gctccgcgcg       300
     ctacggcccg cgggcaccgg tgggtccgcg tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page