(data stored in ACNUC7421 zone)

EMBL: CP002299.PE394

CP002299.PE394       Location/Qualifiers
FT   CDS_pept        489382..491922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0396"
FT                   /product="PKD domain containing protein"
FT                   /note="KEGG: cai:Caci_8514 fibronectin type III domain
FT                   protein; PFAM: PKD domain containing protein; SMART: PKD
FT                   domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78482"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8N9"
FT                   /inference="protein motif:PFAM:PF00801"
FT                   /protein_id="ADP78482.1"
FT                   /translation="MRRWAGPAALVALLVAGVAALVAGSAQGVAARSVSLDDVSAWLLS
FT                   PAVGEAELVDGNSGAVVTRVELGVGALTGTQSGTGEFVADSATGKLRRIDGATYRVSAP
FT                   ATFGKPGEALGVYPAGETVFAVDQPTGLVSLLDPRTLAVRQTYSLAAKVAAGGIVTQGA
FT                   DVLWAVGATTGDLERVDGSGTTIVRHAVDPARTTLVTAAGLPVAVDLTARQVVRLGSRG
FT                   VTGAGTCVDVAATDSSVQVVGSADRPAVYAVSGSRGVLLVSDLATGRCGDAVNLGVAGH
FT                   RLGQPREAAGRVFVPDYTSGQVLVVDVTAGRVIADPTVMPPSTAFELRDEGAVVFYNDP
FT                   ATAKAGVISLDGAIRPIEKYSPATVGTAPGGPASLAGKLPSDAAGGSQPPTGGTSPPSG
FT                   VQPTAVPTRPAATRPQRPTAPLTTIPPVGAGPAVASNDGRTAPTTSTTTEAPATGGGAP
FT                   TVRIAVSAPQARVGTALTMQAVLVAADGTVTAGKLAQVSWSFGDGGSATGSQVTHAWTA
FT                   SGVYTVSADVRLTDGTSAAPVTSVTVVAPNVPPVTTPPVTNPPVTVPPVTTPPTTKPAV
FT                   SPLKAVLSANKGSCTQDSANVTVDASGSAGGSGPLTYAFDFGDGTTAGPASAATVEHGY
FT                   SQTGPFTVTVTITDATGASAKATATATLLHLAASATSVTVGQSVTLTGTGVCAGASLDL
FT                   NIGAQYAGGTSTSGNIGHNVHEPNPYTSTWGTGTTTVSAHWSESDPYSDSNRLTITVTD
FT                   PAPPPPLQVTASSTSITLGQSVTLTATGGVHGSDGTYSWYGANPSGLGTSLCGTTASCT
FT                   TTPDTTGTWKYSVQVYDNAGNRAESNQLAVTVSP"
     gtgcgtcgct gggcggggcc ggcggcgttg gtcgcactgc tggtcgccgg tgtcgccgcc        60
     ctggtggcag gctccgcgca gggcgtcgcg gcgcggtcgg tgagcctgga tgacgtctcc       120
     gcctggctgc tgtctccggc ggtcggtgaa gccgagctgg tcgacgggaa cagcggggcg       180
     gtggtcacgc gcgtcgagct cggcgtaggc gcgctgacgg ggacccagtc cgggaccggc       240
     gagttcgtcg cggacagcgc caccggcaag ctccgccgga tcgacggggc gacctaccgg       300
     gtctccgcgc ccgcgacgtt cgggaagccg ggcgaggcgc tgggggtcta cccggcgggc       360
     gagacggtgt tcgccgtcga tcagccgacc gggttggtca gcctgctgga cccgcgaacg       420
     ctggcggtcc gccagaccta ctcgctggcc gcgaaggtgg ccgccggggg gatcgtcacc       480
     cagggggccg acgtgctgtg ggccgtcggc gcgaccaccg gggacctcga acgggtggac       540
     ggttcgggca cgaccatcgt gcggcacgcc gtcgacccgg cccgcaccac gctggtcacg       600
     gccgccggcc tgccggtcgc ggtcgacctg accgcccgcc aggtggtcag gctcggctcc       660
     cgcggggtca ccggcgccgg gacctgcgtc gacgtcgccg ccaccgactc cagcgtccag       720
     gtcgtcggct cggccgatcg gccggcggtc tacgccgtca gtgggagccg tggcgttctg       780
     ctggtcagcg acctggcgac cgggcgttgc ggcgacgcgg tcaacctcgg ggtggcgggg       840
     catcggctcg ggcagccgcg cgaggccgcg ggccgggtgt tcgtccccga ctacacctcc       900
     ggccaggtgc tggtcgtcga cgtgaccgcc gggcgggtga tcgccgatcc gaccgtgatg       960
     ccgccctcga cggcgttcga actgcgggac gagggcgctg tcgtgttcta caacgatccc      1020
     gcgacggcga aggccggggt gatctcgctc gacggggcga tccgtccgat cgagaagtac      1080
     agcccggcca cggtcggcac cgcccccggc ggcccggcaa gcctcgccgg caagctcccg      1140
     agtgacgcgg cgggtggctc ccagccaccg accggcggca ccagcccgcc gtcaggcgtc      1200
     cagccgaccg ccgtgcctac gcgccccgcc gccacgcggc cgcagcgtcc gacggccccc      1260
     ttgacgacga tcccgcccgt gggcgccggc cccgcggtcg cctcgaacga cggccggaca      1320
     gcgcccacca cctcgaccac taccgaggcg ccggccaccg gtggcggggc gccgaccgtg      1380
     cggatcgcgg tctccgcgcc acaggctcgg gtcggcacgg cactgacgat gcaggcggtg      1440
     ctggtcgccg ccgacgggac ggtcacggcc ggcaagctcg cacaggtgtc gtggtcgttc      1500
     ggcgacgggg gctcggcgac gggctcccag gtcacgcacg cctggacggc gagcggcgtc      1560
     tacacggtgt cggccgacgt tcgcctcacc gacggcacct cggccgcgcc ggtcaccagc      1620
     gtcacggtgg tcgcgcccaa cgtgccgccg gtgacgacgc ccccggtgac aaacccgccg      1680
     gtgacagttc cgcccgtcac gacacccccg acgacgaagc ccgcggtgtc cccgttgaag      1740
     gccgtgctgt cggccaacaa gggcagctgc acccaggaca gcgcgaacgt cacggtcgac      1800
     gcctccggtt cggcgggcgg ttccggtccc ctgacctatg cgttcgactt cggcgacggg      1860
     acgacggccg gcccggcctc ggcggcgacc gtggagcatg ggtactcgca gaccggaccg      1920
     ttcacggtga cagtgacgat cactgacgcg acaggggcct cagcgaaggc gaccgccacg      1980
     gccacgctgc tacatctcgc cgcgagcgcg acgtcggtga ccgtcgggca gtccgtcacc      2040
     ctcacgggca ccggcgtctg cgccggggcc agcctcgacc tgaacatcgg cgctcagtac      2100
     gccggcggga cctccaccag cggaaacatc ggacacaacg tccatgagcc caacccgtac      2160
     acgtccacct ggggcaccgg gacgaccacc gtctccgcgc actggtcgga gtccgatccc      2220
     tattcggact ccaaccgcct cacgatcacc gtcaccgacc cggcgccccc gccaccgcta      2280
     caggtcaccg caagctcgac gtcgatcact ctcggccagt ccgtgaccct tacggcgacg      2340
     ggcggcgtcc acggcagcga tggcacgtat tcgtggtacg gggcgaatcc cagcggcctc      2400
     ggcaccagtc tgtgcggcac gacggcaagc tgcaccacca cgcccgacac caccggcacc      2460
     tggaagtact cggtccaggt ctacgacaac gcgggcaacc gcgcggagtc caaccagctc      2520
     gcggtgaccg tcagcccata g                                                2541
//

If you have problems or comments...

PBIL Back to PBIL home page