(data stored in ACNUC7421 zone)

EMBL: CP002299.PE395

CP002299.PE395       Location/Qualifiers
FT   CDS_pept        complement(491950..492759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0397"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: sro:Sros_6478
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78483"
FT                   /db_xref="GOA:E3J8P0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8P0"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ADP78483.1"
FT                   /translation="MATPSNTYTHGHHESVLRSHRWRTAENSAAYLLPALRPGMTLLDV
FT                   GAGPGTITVDLAERVAPGQVTAVEVSESVLELPRAEAARRGAHTITFAVADVHALRFPD
FT                   DSFDVVHAHQVLQHVADPVLALREMRRVCRPGGVVAVRDSSYSDFDWTPRPPELDEWLD
FT                   LYLRAARANGGEPDAGRHLAGWAREAGFTDVTATTGHWVYESDADRRWWGEMWAERILR
FT                   SDMAGQALARGLASQEDLERISRAWRDWAATPAAAITIPHGEVLARP"
     atggcgactc cgtccaacac ctacacgcac ggccaccacg agtcggtgct gcgctcgcac        60
     cgctggcgga cggccgagaa ctcggccgcg tacctgctgc cggcgttgcg gcccgggatg       120
     acgctgctcg atgtgggcgc agggccgggc acgatcaccg tcgacctggc cgagcgcgtg       180
     gcaccgggcc aggtgacggc ggtcgaggtc agcgagtccg tgctcgagct ccccagggcg       240
     gaggcggccc gacgcggcgc gcacaccatc accttcgcgg tcgcggacgt gcacgccctg       300
     cggttcccgg acgactcctt cgacgtcgtg cacgcccacc aggtcctcca gcacgtggcc       360
     gatccggtgc tggcactgcg tgagatgcgc cgggtatgcc ggccgggcgg cgtggtggcc       420
     gtccgggaca gcagttacag cgacttcgac tggacgccgc ggccgcccga gctggacgag       480
     tggctggacc tgtacctgcg cgcggcccgg gccaacggcg gggagcccga cgcgggacgt       540
     cacctcgccg gctgggcgcg ggaggcgggc ttcaccgacg tcacggcgac caccggtcac       600
     tgggtatacg agtccgacgc cgaccggcgc tggtggggcg agatgtgggc cgaacggatc       660
     ctgcgctccg acatggccgg ccaggcgctg gcccgcggcc tggccagcca ggaggacctg       720
     gagcggatct cccgggcgtg gcgggactgg gcggccaccc cggcagcggc gatcacgatc       780
     ccgcacggcg aggtcctcgc gaggccctga                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page