(data stored in ACNUC7421 zone)

EMBL: CP002299.PE397

CP002299.PE397       Location/Qualifiers
FT   CDS_pept        494431..495348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0399"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   fal:FRAAL4911 chitooligosaccharide deacetylase (nodulation
FT                   protein B homolog) (partial match)"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78485"
FT                   /db_xref="GOA:E3J8P2"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8P2"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ADP78485.1"
FT                   /translation="MSRLRRGRWVSDLAPVEARERDAGRSRRRLTAWALVGAIGLASAG
FT                   VAEAAGPALATEPPPAAAPAPARAGAPAPTTAPAAAHAPAAVPAQGSAGASGAARQRPA
FT                   YTVHRVLPNAPANAIALTFDDGPDPTWTPQVLALLRQYDVRATFCIVGRQARAYPDLVR
FT                   RIVAEGHAICNHSMTHPLPFSHRSAAAIDAEIGGAQSAITAAAGTAPRLFRAPGGDWSP
FT                   PVFSAEASRGLTPVAWNVDPRDWSRPGTQKIVTSLLAAKPGDILLCHDGDGEHPAGVDR
FT                   SETVQALRTVLPQLKSRGLTFVTL"
     atgagcaggc tgaggcgagg gcgatgggtg agcgacctgg cgccggtgga ggctcgggag        60
     cgggacgcgg gccggtcgcg gcgtcggctg acggcctggg cgctcgtggg ggccatcggg       120
     ctggcctcgg ccggcgtggc tgaggccgcg gggccggcgc tggcgaccga gccgccgccg       180
     gctgccgccc ccgcaccggc tcgggccggt gctccggctc cgacgacggc tccggctgcc       240
     gcccacgctc cggctgccgt accggctcag gggtcggcag gtgcttccgg ggccgcccgg       300
     cagcggcccg cctacaccgt gcaccgggtt cttccgaacg cgccggccaa cgcgatcgcg       360
     ctgaccttcg atgacgggcc ggacccgacc tggacgccgc aggtgctcgc gctgctgcgg       420
     cagtacgacg tgcgggcgac cttctgcatc gtcgggcgac aggcacgcgc ctacccggac       480
     ctggtccggc ggatcgtcgc cgaggggcac gcgatctgca accacagcat gacgcacccc       540
     ctgccgttct cgcaccggtc cgcagccgcg atcgacgcgg agatcggtgg cgcccagtcc       600
     gcgatcaccg ccgccgccgg caccgctccg cgcctgttcc gtgcgccggg cggcgactgg       660
     tcgccgcccg tgttcagcgc cgaggccagc cgaggcctga ccccggtcgc ctggaacgtc       720
     gaccccaggg actggtcccg ccccggaacg cagaagatcg tcaccagcct gttggcggcg       780
     aagcccgggg acatcctgct ctgccatgac ggcgacgggg aacacccggc cggcgtggac       840
     cggtcggaga cggtccaggc actgcggacg gtcctgccgc agctgaagag caggggcctg       900
     accttcgtga ccctgtga                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page