(data stored in ACNUC7421 zone)

EMBL: CP002299.PE399

CP002299.PE399       Location/Qualifiers
FT   CDS_pept        complement(496040..496477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0401"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scb:SCAB_9061 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78487"
FT                   /db_xref="GOA:E3J8P4"
FT                   /db_xref="InterPro:IPR004378"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8P4"
FT                   /inference="similar to AA sequence:KEGG:SCAB_9061"
FT                   /protein_id="ADP78487.1"
FT                   /translation="MTQPDDYVPSLFPSVRDQVALYEATDGREGGTLEGRPVVILTHRG
FT                   ARSGKLRKTPVMRIELGPGYLVVASYGGAPNHPSWYHNLIANPLVLVRDGDTLRSMVAR
FT                   EAAGPEKAALWETADAAWPHFPEYRASTTREIPLLVLEPPG"
     gtgacgcagc cagacgacta cgttcccagc ctgtttccct cggttcgaga ccaggtcgcg        60
     ctctacgagg cgaccgacgg ccgggagggt gggaccctgg agggcaggcc cgtcgtaatc       120
     ctcacccatc gcggcgccag atccgggaaa ctgcgcaaga caccggtcat gaggatcgag       180
     ctcggtcccg gctacctcgt ggtggcctcc tacggaggag cgccaaacca tccctcctgg       240
     tatcacaacc tgattgcgaa cccattggtt ttggtccgcg acggcgacac gctcaggtcg       300
     atggtcgccc gggaggcagc cgggcccgag aaggccgcac tgtgggagac agccgacgcg       360
     gcgtggccac attttcccga gtaccgcgcc agcaccacac gcgagatccc actgctcgta       420
     ctcgaaccac cggggtag                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page