(data stored in ACNUC7421 zone)

EMBL: CP002299.PE4

CP002299.PE4         Location/Qualifiers
FT   CDS_pept        5154..5762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0004"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   fal:FRAAL0006 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78092"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:E3J254"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ADP78092.1"
FT                   /translation="MSPDPAEPDQNGAPRVTGADLARQVLAAAKADARARARGGRPGGG
FT                   GSPGRGADASAAGATPGDDDREPPRRPRLPGIAAPGREWREPTSFAASINRMLAARGWQ
FT                   TKAKDSGVLANWDVIVGPEIASHATPVSLRDGLLELEAESTAWATQLRLLAPRLLGVLR
FT                   RELGEGVVSRITVRGPSAPSWRHGPAQMPGGRGPRDTYG"
     atgtcgccgg atccggctga gcccgaccag aacggcgcgc cacgggtcac gggcgcggac        60
     ctcgcccgcc aggtgctcgc cgccgcgaag gcggatgcgc gagccagggc caggggtggt       120
     cgtccgggcg gcgggggcag cccgggccga ggggccgacg cctcggcggc cggcgcgacg       180
     ccgggggacg acgaccggga gccgccgcgc cggccccgcc tgcccgggat cgcggcgccc       240
     ggccgggagt ggcgcgagcc gaccagcttc gccgcctcga tcaaccggat gctcgccgct       300
     aggggctggc agacgaaggc gaaggactcc ggcgttctgg ccaactggga cgtgatcgtc       360
     ggccccgaga tcgcctcgca cgcgaccccg gtctcgctgc gtgacggcct gttggagctg       420
     gaggcggagt ccacggcgtg ggccacccag cttcggctac tggccccgcg gctgctcggc       480
     gtgctgcgtc gcgagctggg cgagggcgtc gtctcccgga tcaccgtgcg cggcccgtcg       540
     gcaccgtcct ggcggcacgg gccggcgcag atgccgggcg gccgcgggcc ccgggacacc       600
     tacggctga                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page