(data stored in ACNUC7421 zone)

EMBL: CP002299.PE400

CP002299.PE400       Location/Qualifiers
FT   CDS_pept        complement(496489..497262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0402"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   sco:SCO6282 3-oxoacyl-[acyl-carrier protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78488"
FT                   /db_xref="GOA:E3J8P5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8P5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ADP78488.1"
FT                   /translation="MGTLAAKTALVTGASRGIGRAVALRLAREGALVAVHYGSNEAAAK
FT                   DTVDTITAAGGRAFALRTHLGHAGDAEALWSAFDDAIRAHTDSPAVDVIVNNAGIALYA
FT                   TVTDVEDKTFDEVFAVNAKAPFFILQHGLDRLREGGRVINISSGAARLATPMLVAYAMT
FT                   KGALNALTRTLALELGPRNITVNSVEPGIVETDIAFFLSDPRMNELAASWSAFNRLGQP
FT                   ADIADVVAFLASPDARWITGQFIDATGGFLLGPKF"
     atgggtacgt tggcagcgaa gacagccctg gtgaccgggg cgagccgcgg gatcggccgg        60
     gccgtcgccc tgcgactggc ccgcgagggc gccctggtcg cggtgcacta cgggagcaac       120
     gaggccgccg ccaaggacac ggtcgacacc atcaccgcag ccgggggccg ggccttcgcg       180
     ctgcggacgc acctcggcca cgcgggagac gcggaagcgc tgtggtccgc cttcgatgac       240
     gccatccggg cacacaccga ctcgccagcg gtggacgtca tcgtcaacaa cgccggcatc       300
     gctctttacg ccaccgtcac cgacgtcgag gacaagacct tcgacgaggt cttcgccgtg       360
     aacgccaagg cgccgttctt catcctccag cacggcctcg accggctgcg cgaaggtggc       420
     cgcgtcatca atatctcgtc gggcgccgcc cggctggcga cgcccatgct cgtcgcctac       480
     gcgatgacca agggcgcgct caacgccctg acacgcaccc tcgccctgga actggggcca       540
     cgcaacatca cggtcaactc cgtcgagcct ggcatcgtcg agaccgacat cgcgttcttt       600
     ctgtccgacc ctcgaatgaa cgagctggca gcgtcctggt cggcgttcaa ccggctcggc       660
     cagccggccg acatcgctga cgtcgtcgcg tttctcgcct cgcccgacgc acggtggatc       720
     acgggtcagt tcatcgacgc gaccggcggc ttcctcctcg gcccgaagtt ctag             774
//

If you have problems or comments...

PBIL Back to PBIL home page