(data stored in ACNUC7421 zone)

EMBL: CP002299.PE401

CP002299.PE401       Location/Qualifiers
FT   CDS_pept        497337..497939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0403"
FT                   /product="regulatory protein TetR"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sco:SCO5238
FT                   TetR-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78489"
FT                   /db_xref="GOA:E3J8P6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8P6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ADP78489.1"
FT                   /translation="MDRSRGGRPREFDRDAALERAVALFWERGYETTSIADLTAGMNIG
FT                   PPSLYAAFGSKRALFDEVVEAYCQQYRAFMVLAFTEEPTFRRGLERLLREAAAAYTQPD
FT                   RPPGCLVVSAAVNCASAEVAEALQGLRNSGVDQLERLAAAAVRAGELPPGLDARALAVF
FT                   TGVVLQGMALRARDGADRRELESTAMIAFEAWPWPAA"
     atggacagat cgcgtggagg acggcctcgg gagttcgacc gggacgccgc cctcgagcgc        60
     gcggtcgcgc tgttctggga gcggggctac gagacgacct cgatcgctga cctcaccgcc       120
     gggatgaaca tcgggccgcc gagcctgtac gcggccttcg gcagcaagcg ggcgttgttc       180
     gacgaggtcg tcgaggccta ctgccagcag taccgagcct tcatggtgct ggccttcacc       240
     gaggagccga cgttccggcg tggcctggaa cggctgctgc gcgaggccgc cgcggcctac       300
     acgcagcccg accggccgcc cggctgcctc gtcgtcagcg cggcggtcaa ctgcgcctcg       360
     gccgaggtcg ccgaggcgct ccaggggctg cgtaactcgg gagtcgacca gcttgagcgc       420
     cttgccgccg ccgcggtccg tgccggcgag ctacccccgg gcctcgacgc gcgggccctg       480
     gccgtgttca ccggggtggt ccttcagggc atggcgctgc gggcccgcga cggagccgac       540
     cggcgagagc tggagtccac cgccatgatc gcgtttgagg cctggccgtg gccggcggcc       600
     tga                                                                     603
//

If you have problems or comments...

PBIL Back to PBIL home page