(data stored in ACNUC7421 zone)

EMBL: CP002299.PE402

CP002299.PE402       Location/Qualifiers
FT   CDS_pept        498175..499011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0404"
FT                   /product="protein of unknown function DUF574"
FT                   /note="PFAM: protein of unknown function DUF574; KEGG:
FT                   fal:FRAAL0617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78490"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8P7"
FT                   /inference="protein motif:PFAM:PF04672"
FT                   /protein_id="ADP78490.1"
FT                   /translation="MTGWDFTSAASDDSPGGALPDLRTDRPTPARMYDYFLGGKDNFDV
FT                   DREAAAKVDAALGRTVTYDVVWENRRFLQRATRYLAAAGIDQFLDIGTGLPTQGNVHEI
FT                   AKQVVAAPRVVYVDNDPIVAVHGRALLASDHTTTIITADAREPAGILTHPDMTALLDLS
FT                   RPVAVLLVALFHFIQDHENPAGLLAEFMDAVPSGSYLVLSHLTTDGPPAEGVARTEAAY
FT                   QNATSPMTFRPRATIASYFDGLDLVEPGLVRPWQWHPGDDDSPRTDWLYAGVARKP"
     atgactggct gggacttcac gtcggctgcc tctgacgact cgccgggcgg tgcgctcccg        60
     gatctgcgga ccgaccggcc gacgccggcg cggatgtacg actacttcct cggcggcaag       120
     gacaacttcg acgtcgaccg ggaggccgcg gcgaaggtcg acgccgcgct cgggcgcacg       180
     gtgacctatg acgtcgtctg ggagaaccgg cgtttcctgc agcgggcgac ccgctacctc       240
     gccgccgccg gcatcgacca gttcctcgac atcggcaccg ggctgcccac ccagggcaac       300
     gtccacgaga tcgccaagca ggtcgtcgcc gccccgcggg tggtctacgt cgacaacgac       360
     ccgatcgtgg cggtgcacgg ccgtgcgctc ctggccagcg accacacgac gacgatcatc       420
     accgcggacg cgcgggagcc ggccggaatc ctcacccatc ccgacatgac ggcgctgctg       480
     gacctctcca ggcccgtcgc cgtcctgctg gtcgccctgt tccacttcat ccaggaccac       540
     gagaacccgg ccggtctgct ggccgagttc atggacgcgg tcccgtcggg ctcctacctg       600
     gtcctgtcgc acctgacgac ggacgggccg ccggccgagg gcgtcgcccg gaccgaggcg       660
     gcctatcaga acgccacgtc accgatgacc ttccggccgc gtgccacgat cgcgagctac       720
     ttcgacggcc tcgacctggt cgagcccggc ctcgtgcgcc cctggcagtg gcaccccggc       780
     gacgacgaca gcccgcggac cgactggctg tacgcgggcg tcgcccgcaa gccgtga          837
//

If you have problems or comments...

PBIL Back to PBIL home page