(data stored in ACNUC7421 zone)

EMBL: CP002299.PE404

CP002299.PE404       Location/Qualifiers
FT   CDS_pept        complement(500281..500643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0406"
FT                   /product="YCII-related protein"
FT                   /note="PFAM: YCII-related; KEGG: sro:Sros_5460 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78492"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8P9"
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /protein_id="ADP78492.1"
FT                   /translation="MKYLLMIYGNQEKWDSIPAEDWPSEIAKQDAYNKKYAATGELLGG
FT                   YGLADAAAARLVTRKDGLPTVTAGPFLETKEYMATFYLVDVENEERAYELAAEMPWADQ
FT                   NPTEVWPILHESANDA"
     atgaagtacc tgctgatgat ctacggcaac caggagaagt gggacagcat cccggccgag        60
     gactggccga gcgagatcgc caagcaggac gcctacaaca agaagtacgc ggctaccggc       120
     gaactgctcg gcgggtacgg gctggcggac gccgcggcgg cgaggctggt gacgcgcaag       180
     gacggtctcc ccaccgtcac cgccggcccc ttcctcgaga ccaaggagta catggccacc       240
     ttctacctgg tcgacgtgga gaacgaggag cgggcctacg agctcgcggc ggagatgccc       300
     tgggccgacc agaacccgac cgaggtctgg ccgatcctgc acgagtcggc gaacgacgcc       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page