(data stored in ACNUC7421 zone)

EMBL: CP002299.PE410

CP002299.PE410       Location/Qualifiers
FT   CDS_pept        507052..507609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0412"
FT                   /product="outer membrane protein"
FT                   /note="KEGG: npu:Npun_F5031 outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78498"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8Q5"
FT                   /inference="similar to AA sequence:KEGG:Npun_F5031"
FT                   /protein_id="ADP78498.1"
FT                   /translation="MKPLVRLGIGVSCAVAVAGLPTPARAASAPTSRPPTMVISQQDRT
FT                   WMVDFARGNRFEIYSGGLAARKGVRPDTRAVGRRLVSDHTTALAALKQLALQLRVSLPT
FT                   TLSADQQRELRKLGSLHGIAFDREFLTFEIADHRKVIGATVQVSRTGTNPQVKAFARHN
FT                   LPTLRTHLRLAQDALTELPPVH"
     atgaagccgc tggtccgcct cggcatcggt gtgagctgtg cggtggcggt cgcggggcta        60
     cccacgcccg cgcgggcggc gtcggccccg accagtcgtc cgccgacgat ggtgatatcc       120
     cagcaggacc gcacgtggat ggtcgacttc gctcggggca accgcttcga gatctatagc       180
     ggtggcctcg ctgcccgcaa gggcgtccgc cccgacaccc gcgcggtggg ccggcggctc       240
     gtatccgacc acaccacggc gctcgccgcg ctgaagcagc tcgccctcca gctgcgggtc       300
     tcgctgccga ccacgctgtc cgccgaccag cagcgcgagt tgcgcaagct cggatcgctg       360
     cacggcattg cgttcgaccg cgagttcctc accttcgaga tcgccgatca tcgcaaggtc       420
     atcggcgcga cggtccaggt ctcccggact gggacaaacc cacaggtcaa ggcctttgcc       480
     cgccacaacc taccgaccct gcgtactcat ctcaggttgg cccaggacgc cctgacggaa       540
     cttccaccgg tccactga                                                     558
//

If you have problems or comments...

PBIL Back to PBIL home page