(data stored in ACNUC7421 zone)

EMBL: CP002299.PE418

CP002299.PE418       Location/Qualifiers
FT   CDS_pept        517031..517972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0423"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   sco:SCO6303 hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78506"
FT                   /db_xref="GOA:E3J8R3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E3J8R3"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ADP78506.1"
FT                   /translation="MRFVTYVDDDGDRVGVVADGQVHALPSGVTLLDLLRAEDGLREAG
FT                   ERALASPSAVRPYSDVRLRAPLPTPPTVRDFMTFERHLEGVLLLGGATVPERWYEAPAF
FT                   YFTNPYAVRGPHDDVPVPPGCQLFDLELEVAAVVGRTGRDVSPEAGDSYIAGYTIMNDW
FT                   SARDLQFAEMEVRLGPTKGKDTATTLGPMLVTPDELQDWAAGTSYDLAMTVEINGELIG
FT                   EDRLSSMAFTFGDLVAYASRGTEVRPGDVLGSGTCGGGCLAELWGRNGFDAHPPLRPGD
FT                   LVTVSVEQLGALTTRITAGTDPVPIPAARRRG"
     gtgcgtttcg tgacctacgt cgatgatgac ggcgaccgcg tcggtgtagt cgccgacggc        60
     caggtgcacg ccctgccctc gggcgtcacg ctgctggatc tgctccgtgc cgaggacggt       120
     ctgcgggagg ccggggaacg ggcgctcgcg tcgcccagtg ccgtgcggcc gtactcggac       180
     gtgcggctac gcgccccgct gcccacaccg cccaccgtcc gcgacttcat gaccttcgag       240
     cggcacctcg aaggggtcct cctcctgggc ggcgcgacgg tccccgaacg gtggtacgag       300
     gctccggcct tctacttcac caatccctac gcggtacgcg gcccgcacga cgacgtgccg       360
     gtgccgcccg gctgccagct tttcgacctt gagctcgagg tcgccgcggt ggtcggccgc       420
     accggccggg acgtgtcccc ggaggcgggc gattcctaca tcgcggggta cacgatcatg       480
     aacgactggt cggcgcggga cctccagttc gccgagatgg aggtcaggct cggcccgacg       540
     aaaggcaagg acaccgcgac cacgcttggg ccgatgctgg tcacgccgga cgagctccag       600
     gactgggcgg ccggtaccag ctacgacctg gccatgaccg ttgagatcaa cggcgagctg       660
     atcggcgagg accggttgtc ctcgatggcg ttcacgttcg gcgacctggt cgcctacgcc       720
     tcccgtggca ccgaggtccg gcccggcgac gtgctcggct ccggcacgtg cggcggaggg       780
     tgcctggccg agttgtgggg tcgaaacggc tttgacgccc atccaccact gcgacccggc       840
     gacctcgtca ccgtcagcgt cgagcagttg ggcgcgctga ccacccgcat cacggccggg       900
     acggacccgg tgccgatccc agcggcccga cgccgcggat ga                          942
//

If you have problems or comments...

PBIL Back to PBIL home page