(data stored in ACNUC7421 zone)

EMBL: CP002299.PE423

CP002299.PE423       Location/Qualifiers
FT   CDS_pept        complement(520165..521079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0428"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: sro:Sros_5789
FT                   alpha/beta hydrolase fold protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78511"
FT                   /db_xref="GOA:E3J9U9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9U9"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ADP78511.1"
FT                   /translation="MKTREDPTIGRFRGDRQRDRFLAAYDRAFALWPTPWTQTAVETRF
FT                   GTTHVHRYGPPDAEGGVPIVLLHGAGSNAVQWYPFVAALGERRPVVALDTLGDPGRSIA
FT                   RAPIHEPASSAAWLDEALTELGIGSAHLIGHSYGGWLALNQALHSPDRLVTVAALDPGG
FT                   LEKVGARFFWKMYLNGLAGLTAGPLRRRLAVRLDNPVLLVPELRKVLLTGARSFRTRRP
FT                   APRPLQDDELRRIRTPTLVLIGERSPLLHPDRAQARVTLMPNGRAEILPGVGHGPGFDH
FT                   GNDVNARLLAFLDANAPSTAASP"
     atgaaaacac gtgaagatcc gaccatcggc cggttccgcg gtgaccgcca gcgtgaccgg        60
     ttcctcgccg cgtacgaccg ggcgttcgcg ttgtggccca cgccctggac gcagactgcc       120
     gtcgagaccc gcttcggcac cacccacgtg caccggtacg gccctcccga cgccgagggc       180
     ggggtgccga tcgtgctcct gcacggcgcg ggttcgaacg cggtccagtg gtacccgttc       240
     gtcgccgcgc tcggcgagcg acgcccggtc gtcgccctcg acacgctggg cgatccgggc       300
     cgcagcatcg cccgcgcgcc gatccacgag ccggcgtcca gcgcggcctg gctcgacgag       360
     gccctcacgg agctcggtat cggcagcgca catctcatcg gccactcgta cggcggctgg       420
     ctcgcgctca accaggcgct gcacagtccc gaccgactgg tcaccgtcgc cgcgctggac       480
     ccgggtggcc tggagaaggt cggcgcccgg ttcttctgga agatgtacct caacgggctg       540
     gccggtctca ccgcaggacc gctacgccgc cggctcgccg tccgcctgga caacccggtc       600
     ctgctcgtcc cagagctgag gaaggtcctg ctcaccggcg cccgctcgtt ccgcacgcgc       660
     cggccggccc cgcggccgct ccaggacgac gagctgcgaa ggatccggac tcccaccctg       720
     gtcctgatcg gcgaacgctc gccgctgctg cacccggacc gcgctcaggc acgagtcacc       780
     ctgatgccga acggccgggc cgagatcctc ccgggagtgg gccacggccc cgggttcgac       840
     cacggcaacg acgtcaacgc ccgcctgctc gccttcctgg acgccaacgc tccttcgacc       900
     gccgcgagcc cgtaa                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page