(data stored in ACNUC7421 zone)

EMBL: CP002299.PE425

CP002299.PE425       Location/Qualifiers
FT   CDS_pept        522091..522507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0430"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="KEGG: fal:FRAAL6416 hypothetical protein; PFAM:
FT                   ATP-binding region ATPase domain protein; SMART:
FT                   ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78513"
FT                   /db_xref="GOA:E3J9V1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9V1"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ADP78513.1"
FT                   /translation="MESEQTEEFWIAPDPAAIRDTRRAVLRLCRETNLPADTRETAVLL
FT                   TSETVTNAIVHGGPPARLVIRVSPGVIRVEVTDSTDRLPVVVPARPDATNGRGIGLVDA
FT                   LATRWGVQRHSGGKTVWFEISQASSPSPPPPSTG"
     atggagagtg agcagaccga ggagttctgg atcgcacccg atccagcggc cattcgcgac        60
     acgcgtcgcg cggtgctccg gctttgccgg gaaacgaacc tccccgccga cacccgcgag       120
     accgccgtcc tgctcaccag cgagacggtg acgaacgcca tcgtgcatgg tggtccaccc       180
     gcgcgcctgg tcatccgggt ctcgcctggt gttatccgcg tcgaggtcac cgacagcacc       240
     gaccgccttc cggtggtcgt tcccgctcgg cccgacgcga cgaacggccg cggcatcggg       300
     ctggtcgacg cgctcgccac tcgctggggt gtccagcggc attccggcgg aaagaccgtg       360
     tggttcgaga tctcccaggc ctcgtcgccc agtccgccgc cgccgtcgac tggttga          417
//

If you have problems or comments...

PBIL Back to PBIL home page