(data stored in ACNUC7421 zone)

EMBL: CP002299.PE428

CP002299.PE428       Location/Qualifiers
FT   CDS_pept        523514..524017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0433"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rop:ROP_45610 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78516"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9V4"
FT                   /inference="similar to AA sequence:KEGG:ROP_45610"
FT                   /protein_id="ADP78516.1"
FT                   /translation="MADIVDLVYADHDWLRRQFFYLDYATGNAELTAVWEALATRLDTH
FT                   ADAEETVFYPTLLKKGDSGDPEEETEDAIDDHNKIRAAVTDARSHRVGTKVWFEAVGAA
FT                   RTENGKHLDEEEREAIPDFIKSTSPELRHQLAMRWLQFYADHRDGAGVNTKSKDAAEYI
FT                   EANS"
     atggctgaca tcgtcgatct ggtctacgcc gatcacgatt ggctgcggcg ccagttcttc        60
     tacctcgact acgcgaccgg caacgccgag ttgacggcgg tgtgggaggc gctcgcgacc       120
     cggttggaca cccacgcgga cgcggaggag acggttttct acccgactct gctgaagaag       180
     ggcgactccg gcgatcctga ggaggagacc gaggacgcga tcgacgacca caacaagatc       240
     cgagcggccg tgacggacgc ccgctcccac cgggtcggca ccaaggtctg gttcgaggcg       300
     gtcggcgcgg cccggaccga gaacggcaag cacctcgatg aagaggaacg cgaggcgatc       360
     ccggatttca tcaagagcac cagccccgaa ctgcgccacc agctggcgat gcggtggctc       420
     cagttctatg ccgaccaccg ggacggcgcg ggcgtgaaca cgaagagcaa ggacgccgcg       480
     gaatacatcg aggcgaacag ctga                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page