(data stored in ACNUC7421 zone)

EMBL: CP002299.PE430

CP002299.PE430       Location/Qualifiers
FT   CDS_pept        526538..527125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0435"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="KEGG: cai:Caci_0030 RNA polymerase, sigma-24
FT                   subunit, ECF subfamily; TIGRFAM: RNA polymerase sigma-70
FT                   factor, sigma-E family; RNA polymerase sigma factor,
FT                   sigma-70 family; PFAM: Sigma-70 region 4 type 2; sigma-70
FT                   region 2 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78518"
FT                   /db_xref="GOA:E3J9V6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9V6"
FT                   /inference="protein motif:TFAM:TIGR02983"
FT                   /protein_id="ADP78518.1"
FT                   /translation="MDIEDDAFDDYFVARLPGLLRFAYLLTGDFGEAEDLTQTALARTF
FT                   RVWKRVRSHDRPDAYVRRVMVNANARRFRRRRPHQVLVAHPPDRPGRSPELGAVEDRAG
FT                   LVQALASLPQRQRAVVILRYCDDLAETEVAALLGCSVGTVKSQASKGLAKLRTHPALSD
FT                   LGPSSRALAAASGSTAPRLTDPRVTAIRREAQ"
     atggatatcg aggacgacgc attcgatgac tacttcgtcg cccggctgcc tggactgttg        60
     cgcttcgcct acctgctgac cggcgatttc ggtgaggcgg aggatctgac gcagaccgcg       120
     ctcgcgcgca ccttccgggt ctggaaacgc gtgcggtcgc acgaccggcc cgacgcgtac       180
     gtgcgacggg tgatggtgaa cgcgaacgcc cggcggttcc gccgacggcg gccgcaccag       240
     gtcctcgtgg cccacccgcc ggaccggccg ggccgctcgc cggagctcgg cgcggtggag       300
     gaccgcgccg gcctggtcca ggcgttggcc agcctgccgc agcggcagcg cgctgtcgtg       360
     atcctgcgct actgcgacga cctggccgag acagaggtcg cggccctgct cggctgttcg       420
     gtcgggacgg tcaagagcca ggcgtcgaag ggactggcca agctgcggac ccacccggcc       480
     ctgtccgatc tcggcccgtc gtcacgggcc ctggccgccg cgtccggcag caccgcgccc       540
     cgcctcaccg atccccgggt caccgcgatc aggagggaag cacagtga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page