(data stored in ACNUC7421 zone)
EMBL: CP002299.PE430
CP002299.PE430 Location/Qualifiers
FT CDS_pept 526538..527125
FT /codon_start=1
FT /transl_table=11
FT /locus_tag="FraEuI1c_0435"
FT /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT /note="KEGG: cai:Caci_0030 RNA polymerase, sigma-24
FT subunit, ECF subfamily; TIGRFAM: RNA polymerase sigma-70
FT factor, sigma-E family; RNA polymerase sigma factor,
FT sigma-70 family; PFAM: Sigma-70 region 4 type 2; sigma-70
FT region 2 domain protein"
FT /db_xref="EnsemblGenomes-Gn:FraEuI1c_0435"
FT /db_xref="EnsemblGenomes-Tr:ADP78518"
FT /db_xref="GOA:E3J9V6"
FT /db_xref="InterPro:IPR007627"
FT /db_xref="InterPro:IPR013249"
FT /db_xref="InterPro:IPR013324"
FT /db_xref="InterPro:IPR013325"
FT /db_xref="InterPro:IPR014284"
FT /db_xref="InterPro:IPR014325"
FT /db_xref="InterPro:IPR036388"
FT /db_xref="InterPro:IPR039425"
FT /db_xref="UniProtKB/TrEMBL:E3J9V6"
FT /inference="protein motif:TFAM:TIGR02983"
FT /protein_id="ADP78518.1"
FT /translation="MDIEDDAFDDYFVARLPGLLRFAYLLTGDFGEAEDLTQTALARTF
FT RVWKRVRSHDRPDAYVRRVMVNANARRFRRRRPHQVLVAHPPDRPGRSPELGAVEDRAG
FT LVQALASLPQRQRAVVILRYCDDLAETEVAALLGCSVGTVKSQASKGLAKLRTHPALSD
FT LGPSSRALAAASGSTAPRLTDPRVTAIRREAQ"
atggatatcg aggacgacgc attcgatgac tacttcgtcg cccggctgcc tggactgttg 60
cgcttcgcct acctgctgac cggcgatttc ggtgaggcgg aggatctgac gcagaccgcg 120
ctcgcgcgca ccttccgggt ctggaaacgc gtgcggtcgc acgaccggcc cgacgcgtac 180
gtgcgacggg tgatggtgaa cgcgaacgcc cggcggttcc gccgacggcg gccgcaccag 240
gtcctcgtgg cccacccgcc ggaccggccg ggccgctcgc cggagctcgg cgcggtggag 300
gaccgcgccg gcctggtcca ggcgttggcc agcctgccgc agcggcagcg cgctgtcgtg 360
atcctgcgct actgcgacga cctggccgag acagaggtcg cggccctgct cggctgttcg 420
gtcgggacgg tcaagagcca ggcgtcgaag ggactggcca agctgcggac ccacccggcc 480
ctgtccgatc tcggcccgtc gtcacgggcc ctggccgccg cgtccggcag caccgcgccc 540
cgcctcaccg atccccgggt caccgcgatc aggagggaag cacagtga 588
//
If you have problems or comments...
Back to PBIL home page