(data stored in ACNUC7421 zone)

EMBL: CP002299.PE432

CP002299.PE432       Location/Qualifiers
FT   CDS_pept        528621..529211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0437"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: xfn:XfasM23_1067 filamentation induced by cAMP
FT                   protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78520"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9V8"
FT                   /inference="protein motif:PFAM:PF02661"
FT                   /protein_id="ADP78520.1"
FT                   /translation="MDDDPYVWPGTDCLQNLLGIRDREEFHKAEHEVVRARRLQLDTAF
FT                   LPGNYDTDHLRGFHRYLFQDVYDWAGQFRQGDISKDGQPFTPGGQLIERLDALFERVAA
FT                   RKLLVGMDWEPFVGGFALVYGDLNAIHPFREGNGRTQRAFLRQLAAHAGWTVDWSSLGR
FT                   FANARACERYMKTGKPHHLVRVLAPIIVARNKR"
     atggatgacg acccgtacgt ctggccgggt acggactgcc tgcagaacct gctcggcatc        60
     cgggaccgcg aggagttcca caaggccgag cacgaggtcg tgcgcgcccg caggctccag       120
     ctcgacacgg cgttcctgcc cggcaactac gacacggatc acctgcgggg cttccaccgc       180
     tacctgttcc aggacgtcta cgactgggcc ggccagttcc gccagggtga catctccaag       240
     gacggccagc cgttcactcc cggtgggcag ctcatcgaac ggctcgacgc cctgttcgag       300
     cgggtcgcgg cccgcaagct cctcgtcggg atggactggg aaccgttcgt cggcgggttc       360
     gccctggtgt acggcgacct gaacgccatc cacccgttcc gcgagggcaa cgggcgaacc       420
     cagcgcgcgt tcctgcgcca gctcgccgcg cacgccggct ggacggtcga ctggagctcg       480
     ctcggccgct tcgcgaatgc gcgcgcgtgc gagcgctaca tgaaaactgg caagccgcac       540
     catctggtgc gggtcctcgc ccccatcatc gtggcgcgca acaagcgcta a                591
//

If you have problems or comments...

PBIL Back to PBIL home page