(data stored in ACNUC7421 zone)

EMBL: CP002299.PE437

CP002299.PE437       Location/Qualifiers
FT   CDS_pept        complement(534980..535945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0442"
FT                   /product="protein of unknown function DUF422"
FT                   /note="PFAM: protein of unknown function DUF422; KEGG:
FT                   mpa:MAP3817c hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78525"
FT                   /db_xref="GOA:E3J9W3"
FT                   /db_xref="InterPro:IPR007354"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9W3"
FT                   /inference="protein motif:PFAM:PF04240"
FT                   /protein_id="ADP78525.1"
FT                   /translation="MAIEAQGGPAAVGTNESAAPEVVKGPTRGGPRVTAAWVLALVALV
FT                   AAVAGAVGGTGPVGDAALGLLTGVALLFSIVHGSLSVGWRGIGTFFVISYAVGFVLEAT
FT                   SVAYGFPFGFYVHNTGGPRLLDIPLVVPSAYFGYGWIAWVLACVIGRGTPARSVGFERF
FT                   TTPLVATLILTGWDFAFDAVFATVDSRYRYTHPGGYFGVPVSNFLGWLLTGWIITQVFA
FT                   LVEQKAATRTPPAARAHWALPSVVWAAPILPLLGCFLSPPAGKVTVGGRTFVSADIYGS
FT                   AFVVSLLTLGLVAALALIRALAPTGTAPDATRDAQLRALP"
     atggctatcg aggcccaagg gggaccagcc gcggtcggca cgaacgagag cgcggcgccc        60
     gaggtggtca aggggcccac ccggggcggc ccacgggtca ccgccgcctg ggtcctggcg       120
     ctcgtcgcgc tggtcgccgc cgtggcaggg gcggtcgggg gaaccggtcc ggtcggcgac       180
     gccgcgctgg gcctgctgac cggcgtcgcg ctgctgttca gcatcgtcca cggttcgctc       240
     tccgtgggct ggcgcggtat cgggaccttc ttcgtgatca gctacgcggt cgggttcgtc       300
     ctggaggcga ccagcgtcgc gtacggcttc ccgttcggct tctacgtgca caacacgggc       360
     gggccccgcc ttcttgatat cccgctcgtg gtgccgtcgg cctacttcgg atacggctgg       420
     atcgcctggg tgctggcctg cgtgatcgga cgcggcacgc cggcccggtc ggtgggcttc       480
     gagcgcttca ccacgcctct ggtcgcgacg ctgatcctca ccggctggga cttcgccttc       540
     gacgcggtgt tcgcgacggt cgattcccgg taccggtaca cccacccggg cggctacttc       600
     ggcgtacccg tctcgaactt tctcgggtgg ctgcttaccg gctggatcat cacgcaggtc       660
     ttcgcgctgg tcgagcagaa ggccgccacc cggacaccac cggccgcccg ggctcactgg       720
     gccctcccga gcgtggtgtg ggcggcgccc atccttccac tgctcgggtg ctttctgtcc       780
     ccgcccgcgg gaaaggtcac cgtgggcggc agaacgttcg tgtcggccga catctacggg       840
     tcggcattcg tcgtcagcct gctgacgctt ggcctcgtcg ccgcgctggc tctgatcagg       900
     gcgctcgccc cgaccgggac cgcaccggat gcgacacgcg acgcgcagct ccgcgcattg       960
     ccctga                                                                  966
//

If you have problems or comments...

PBIL Back to PBIL home page