(data stored in ACNUC7421 zone)

EMBL: CP002299.PE438

CP002299.PE438       Location/Qualifiers
FT   CDS_pept        536242..536697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0443"
FT                   /product="ribonucleoside-diphosphate reductase,
FT                   adenosylcobalamin-dependent"
FT                   /note="KEGG: nml:Namu_3976 ribonucleoside-diphosphate
FT                   reductase, adenosylcobalamin-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78526"
FT                   /db_xref="UniProtKB/TrEMBL:E3J9W4"
FT                   /inference="similar to AA sequence:KEGG:Namu_3976"
FT                   /protein_id="ADP78526.1"
FT                   /translation="MVTGTQERHIARQRAAVTRSFTVGGAQGYLLTSRCSDGTPADLRL
FT                   IMGRPGTTLHGLLDTVAVAISTGLQTGIPLATFVRRFADTRFEPAGLTDDPEIPEVTSV
FT                   VDYVVRRLALDYLTLEDRVPLDVLTPLERAATRPRHAGPVGWRAGRS"
     gtggtcaccg gtacgcagga gcgacacatc gcgcggcagc gcgcggctgt caccaggtcc        60
     ttcaccgtcg ggggcgccca gggctacctg ctcacctcgc ggtgctcgga cggcacgccc       120
     gcggacctgc gactcatcat gggccggccc ggcacgacgc tgcatggcct gctcgacacg       180
     gtggccgtcg cgatctcgac cggcctgcag accggcatcc cgctggccac gttcgtccgc       240
     cggttcgccg acacgcggtt cgagcccgcc gggctcaccg acgatccgga gatccccgag       300
     gtgacctcgg tcgtcgacta cgtggtccgc cggctcgcgc tggactacct gacgctcgag       360
     gaccgcgtcc cgctggacgt cctcacgccc ctggagcggg ccgcgacgag accacgccac       420
     gccggcccgg tcggctggcg cgctggccgg tcatga                                 456
//

If you have problems or comments...

PBIL Back to PBIL home page