(data stored in ACNUC7421 zone)

EMBL: CP002299.PE44

CP002299.PE44        Location/Qualifiers
FT   CDS_pept        complement(49394..50275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FraEuI1c_0044"
FT                   /product="methyltransferase"
FT                   /note="KEGG: fal:FRAAL3616 hypothetical protein; TIGRFAM:
FT                   methyltransferase; PFAM: Leucine carboxyl
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FraEuI1c_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ADP78132"
FT                   /db_xref="GOA:E3J294"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E3J294"
FT                   /inference="protein motif:TFAM:TIGR00027"
FT                   /protein_id="ADP78132.1"
FT                   /translation="MRAEGGSRTAVLTCQGRAVADGSSAAGRFADAVAADLLRPDERLV
FT                   VEQVRAGTPPKGVAARMAYESAKACASVMVPRTIAADDAIRDRPGGVASQLVLLGAGLD
FT                   ARAWRMPELAGTDVFEVDHPASQRDKRDRLAGRPSLARSLTFVPVDFSRDKLAEALAAA
FT                   GFQTSEPTTWVWEGVVPYLTPAEVSATTAAAGELSAPGSRLVVLYLTPNARASVGVLVA
FT                   RTMSALARQRSVWADEPRRSAWTPPKLAALLATHGFAVTRDESLLAISERLGLPGTRGA
FT                   SIAHAHLAVADR"
     atgcgggccg agggcggaag ccggacggcg gtactgacct gtcagggacg ggccgtcgcc        60
     gacgggagca gcgccgccgg gcggttcgcc gacgccgtcg cggccgacct gctgcgcccc       120
     gacgagcggc tcgtcgtcga gcaggtgcgg gccgggacac cacccaaggg cgtggcggcg       180
     cggatggcct acgagtcggc gaaggcctgc gcctcggtga tggtgccgcg cacgatcgcg       240
     gccgacgacg ccatcaggga ccggcccggt ggcgtggcgt cgcagctggt cctgctgggc       300
     gccgggctgg acgccagagc ctggcggatg cccgagctcg ccggcacaga cgtcttcgag       360
     gtcgaccatc cggcgtccca gcgggacaag cgcgaccggc tcgccggccg gccatccctc       420
     gcccgctcgc tgacgttcgt cccggtggac ttctccaggg acaagctcgc cgaggcgctc       480
     gcggccgccg gtttccagac ctcggagccg acgacctggg tctgggaggg cgtcgtcccc       540
     tacctgaccc cggccgaggt cagcgcgacg acggccgccg ccggcgagct ctccgccccg       600
     ggcagccgac tggtcgtgct ctacctgacc ccgaatgcca gggcatccgt cggcgtgctg       660
     gtcgcccgca cgatgagcgc gctcgcccgc cagcgcagcg tctgggccga cgagccccgc       720
     cggtccgcct ggactccgcc gaagctcgcg gccctgctcg ccacgcatgg cttcgccgtg       780
     acacgcgacg agtccctgct cgcgatctcc gagcgcctcg gcctgccggg cacacgcggc       840
     gcctccatcg cgcacgccca cctggccgtc gccgaccgct ga                          882
//

If you have problems or comments...

PBIL Back to PBIL home page